Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01349
Secondary Accession Numbers
  • 6645
Name V-type proton ATPase subunit d 1
Synonyms
  1. 32 kDa accessory protein
  2. V-ATPase 40 kDa accessory protein
  3. V-ATPase AC39 subunit
  4. V-ATPase subunit d 1
  5. Vacuolar proton pump subunit d 1
  6. p39
Gene Name ATP6V0D1
Protein Type Enzyme
Biological Properties
General Function Involved in hydrogen ion transmembrane transporter activity
Specific Function Subunit of the integral membrane V0 complex of vacuolar ATPase. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system. May play a role in coupling of proton transport and ATP hydrolysis
Pathways Not Available
Reactions Not Available
GO Classification
Component
macromolecular complex
protein complex
proton-transporting two-sector atpase complex, proton-transporting domain
proton-transporting v-type atpase, v0 domain
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
cation transmembrane transporter activity
inorganic cation transmembrane transporter activity
monovalent inorganic cation transmembrane transporter activity
hydrogen ion transmembrane transporter activity
transporter activity
Process
purine nucleotide metabolic process
purine nucleotide biosynthetic process
purine nucleoside triphosphate biosynthetic process
purine ribonucleoside triphosphate biosynthetic process
metabolic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
atp synthesis coupled proton transport
atp biosynthetic process
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 16q22.1
SNPs ATP6V0D1
Gene Sequence
>1056 bp
ATGTCGTTCTTCCCGGAGCTTTACTTTAACGTGGACAATGGCTACTTGGAGGGACTGGTG
CGCGGCCTGAAGGCCGGGGTGCTCAGCCAGGCCGACTACCTCAACCTGGTGCAGTGCGAG
ACGCTAGAGGACTTGAAACTGCATCTGCAGAGCACTGATTATGGTAACTTCCTGGCCAAC
GAGGCATCACCTCTGACGGTGTCAGTCATCGATGACCGGCTCAAGGAGAAGATGGTGGTG
GAGTTCCGCCACATGAGGAACCATGCCTATGAGCCACTCGCCAGCTTCCTAGACTTCATT
ACTTACAGTTACATGATCGACAACGTGATCCTGCTCATCACAGGCACGCTGCACCAGCGC
TCCATCGCTGAGCTCGTGCCCAAGTGCCACCCACTAGGCAGCTTCGAGCAGATGGAGGCC
GTGAACATTGCTCAGACACCTGCTGAGCTCTACAATGCCATTCTGGTGGACACGCCTCTT
GCGGCTTTTTTCCAGGACTGCATTTCAGAGCAGGACCTTGACGAGATGAACATCGAGATC
ATCCGCAACACCCTCTACAAGGCCTACCTGGAGTCCTTCTACAAGTTCTGCACCCTACTG
GGCGGGACTACGGCTGATGCCATGTGCCCCATCCTGGAGTTTGAAGCAGACCGCCGCGCC
TTCATCATCACCATCAATTCTTTCGGCACAGAGCTGTCCAAAGAGGACCGTGCCAAGCTC
TTTCCACACTGTGGGCGGCTCTACCCTGAGGGCCTGGCGCAGCTGGCTCGGGCTGACGAC
TATGAACAGGTCAAGAACGTGGCCGATTACTACCCGGAGTACAAGCTGCTCTTCGAGGGT
GCAGGTAGCAACCCTGGAGACAAGACGCTGGAGGACCGATTCTTTGAGCACGAGGTAAAG
CTGAACAAGTTGGCCTTCCTGAACCAGTTCCACTTTGGTGTCTTCTATGCCTTCGTGAAG
CTCAAGGAGCAGGAGTGTCGCAACATCGTGTGGATCGCTGAATGTATCGCCCAGCGCCAC
CGCGCCAAAATCGACAACTACATCCCTATCTTCTAG
Protein Properties
Number of Residues 351
Molecular Weight 40328.7
Theoretical pI 4.63
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>V-type proton ATPase subunit d 1
MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLAN
EASPLTVSVIDDRLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQR
SIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEI
IRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKL
FPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVK
LNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF
GenBank ID Protein 14250784
UniProtKB/Swiss-Prot ID P61421
UniProtKB/Swiss-Prot Entry Name VA0D1_HUMAN
PDB IDs Not Available
GenBank Gene ID BC008861
GeneCard ID ATP6V0D1
GenAtlas ID ATP6V0D1
HGNC ID HGNC:13724
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Smith AN, Borthwick KJ, Karet FE: Molecular cloning and characterization of novel tissue-specific isoforms of the human vacuolar H(+)-ATPase C, G and d subunits, and their evaluation in autosomal recessive distal renal tubular acidosis. Gene. 2002 Sep 4;297(1-2):169-77. [PubMed:12384298 ]
  3. van Hille B, Vanek M, Richener H, Green JR, Bilbe G: Cloning and tissue distribution of subunits C, D, and E of the human vacuolar H(+)-ATPase. Biochem Biophys Res Commun. 1993 Nov 30;197(1):15-21. [PubMed:8250920 ]
  4. Agarwal AK, White PC: Structure of the VPATPD gene encoding subunit D of the human vacuolar proton ATPase. Biochem Biophys Res Commun. 2000 Dec 20;279(2):543-7. [PubMed:11118322 ]