Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01354
Secondary Accession Numbers
  • 6650
Name Phosphatidylinositol-5-phosphate 4-kinase type-2 beta
Synonyms
  1. 1-phosphatidylinositol-5-phosphate 4-kinase 2-beta
  2. Diphosphoinositide kinase 2-beta
  3. PI(5)P 4-kinase type II beta
  4. PIP4KII-beta
  5. Phosphatidylinositol-5-phosphate 4-kinase type II beta
  6. PtdIns(5)P-4-kinase isoform 2-beta
Gene Name PIP4K2B
Protein Type Enzyme
Biological Properties
General Function Involved in phosphatidylinositol phosphate kinase activity
Specific Function Participates in the biosynthesis of phosphatidylinositol-4,5-bisphosphate
Pathways Not Available
Reactions Not Available
GO Classification
Function
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
phosphatidylinositol phosphate kinase activity
lipid kinase activity
Process
metabolic process
phosphatidylinositol metabolic process
organophosphate metabolic process
phospholipid metabolic process
glycerophospholipid metabolic process
phosphoinositide metabolic process
Cellular Location
  1. Cell membrane
  2. Peripheral membrane protein
  3. Peripheral membrane protein
  4. Endoplasmic reticulum membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 17q12
SNPs PIP4K2B
Gene Sequence
>1251 bp
ATGTCGTCCAACTGCACCAGCACCACGGCGGTGGCGGTGGCGCCGCTCAGCGCCAGCAAG
ACCAAGACCAAGAAGAAGCATTTCGTGTGCCAGAAAGTGAAGCTATTCCGGGCCAGCGAG
CCGATCCTCAGCGTCCTGATGTGGGGGGTGAACCACACGATCAATGAGCTGAGCAATGTT
CCTGTTCCTGTCATGCTAATGCCAGATGACTTCAAAGCCTACAGCAAGATCAAGGTGGAC
AATCATCTCTTCAATAAGGAGAACCTGCCCAGCCGCTTTAAGTTTAAGGAGTATTGCCCC
ATGGTGTTCCGAAACCTTCGGGAGAGGTTTGGAATTGATGATCAGGATTACCAGAATTCA
GTGACGCGCAGCGCCCCCATCAACAGTGACAGCCAGGGTCGGTGTGGCACGCGTTTCCTC
ACCACCTACGACCGGCGCTTTGTCATCAAGACTGTGTCCAGCGAGGACGTGGCGGAGATG
CACAACATCTTAAAGAAATACCACCAGTTTATAGTGGAGTGTCATGGCAACACGCTTTTG
CCACAGTTCCTGGGCATGTACCGCCTGACCGTGGATGGTGTGGAAACCTACATGGTGGTT
ACCAGGAACGTGTTCAGCCATCGGCTCACTGTGCATCGCAAGTATGACCTCAAGGGTTCT
ACGGTTGCCAGAGAAGCGAGCGACAAGGAGAAGGCCAAGGACTTGCCAACATTCAAAGAC
AATGACTTCCTCAATGAAGGGCAGAAGCTGCATGTGGGAGAGGAGAGTAAAAAGAACTTC
CTGGAGAAACTGAAGCGGGACGTTGAGTTCTTGGCACAGCTGAAGATCATGGACTACAGC
CTGCTGGTGGGCATCCACGACGTGGACCGGGCAGAGCAGGAGGAGATGGAGGTGGAGGAG
CGGGCAGAGGACGAGGAGTGTGAGAATGATGGGGTGGGTGGCAACCTACTCTGCTCCTAT
GGCACACCTCCGGACAGCCCTGGCAACCTCCTCAGCTTTCCTCGGTTCTTTGGTCCTGGG
GAATTCGACCCCTCTGTTGACGTCTATGCCATGAAAAGCCATGAAAGTTCCCCCAAGAAG
GAGGTGTATTTCATGGCCATCATTGATATCCTCACGCCATACGATACAAAGAAGAAAGCT
GCACATGCTGCCAAAACGGTGAAACACGGGGCAGGGGCCGAGATCTCGACTGTGAACCCT
GAGCAGTACTCCAAACGCTTCAACGAGTTTATGTCCAACATCCTGACGTAG
Protein Properties
Number of Residues 416
Molecular Weight 47377.6
Theoretical pI 7.37
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Phosphatidylinositol-5-phosphate 4-kinase type-2 beta
MSSNCTSTTAVAVAPLSASKTKTKKKHFVCQKVKLFRASEPILSVLMWGVNHTINELSNV
PVPVMLMPDDFKAYSKIKVDNHLFNKENLPSRFKFKEYCPMVFRNLRERFGIDDQDYQNS
VTRSAPINSDSQGRCGTRFLTTYDRRFVIKTVSSEDVAEMHNILKKYHQFIVECHGNTLL
PQFLGMYRLTVDGVETYMVVTRNVFSHRLTVHRKYDLKGSTVAREASDKEKAKDLPTFKD
NDFLNEGQKLHVGEESKKNFLEKLKRDVEFLAQLKIMDYSLLVGIHDVDRAEQEEMEVEE
RAEDEECENDGVGGNLLCSYGTPPDSPGNLLSFPRFFGPGEFDPSVDVYAMKSHESSPKK
EVYFMAIIDILTPYDTKKKAAHAAKTVKHGAGAEISTVNPEQYSKRFNEFMSNILT
GenBank ID Protein 4505819
UniProtKB/Swiss-Prot ID P78356
UniProtKB/Swiss-Prot Entry Name PI42B_HUMAN
PDB IDs
GenBank Gene ID NM_003559.4
GeneCard ID PIP4K2B
GenAtlas ID PIP4K2B
HGNC ID HGNC:8998
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  3. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  4. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  5. Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ: Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer. Cell. 2007 Dec 14;131(6):1190-203. [PubMed:18083107 ]
  6. Castellino AM, Parker GJ, Boronenkov IV, Anderson RA, Chao MV: A novel interaction between the juxtamembrane region of the p55 tumor necrosis factor receptor and phosphatidylinositol-4-phosphate 5-kinase. J Biol Chem. 1997 Feb 28;272(9):5861-70. [PubMed:9038203 ]
  7. Rao VD, Misra S, Boronenkov IV, Anderson RA, Hurley JH: Structure of type IIbeta phosphatidylinositol phosphate kinase: a protein kinase fold flattened for interfacial phosphorylation. Cell. 1998 Sep 18;94(6):829-39. [PubMed:9753329 ]