You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01369
Secondary Accession Numbers
  • 6665
Name Serine/threonine-protein kinase DCLK1
Synonyms
  1. Doublecortin domain-containing protein 3A
  2. Doublecortin-like and CAM kinase-like 1
  3. Doublecortin-like kinase 1
Gene Name DCLK1
Protein Type Unknown
Biological Properties
General Function Involved in intracellular signaling pathway
Specific Function Probable kinase that may be involved in a calcium- signaling pathway controlling neuronal migration in the developing brain. May also participate in functions of the mature nervous system
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein kinase activity
protein serine/threonine kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
intracellular signaling pathway
signaling
signaling pathway
phosphorylation
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 13q13
SNPs DCLK1
Gene Sequence
>2190 bp
ATGTCCTTCGGCAGAGACATGGAGCTGGAGCACTTCGACGAGCGGGATAAGGCGCAGAGA
TACAGCCGAGGGTCGCGGGTGAACGGCCTGCCGAGCCCGACGCACAGCGCCCACTGCAGC
TTCTACCGCACCCGCACGCTGCAGACGCTCAGCTCCGAGAAGAAGGCCAAGAAAGTTCGT
TTCTATCGAAACGGAGATCGATACTTCAAAGGGATTGTGTATGCCATCTCCCCAGACCGG
TTCCGATCTTTTGAGGCCCTGCTGGCTGATTTGACCCGAACTCTGTCGGATAACGTGAAT
TTGCCCCAGGGAGTGAGAACAATCTACACCATTGATGGGCTCAAGAAGATTTCCAGCCTG
GACCAACTGGTGGAAGGAGAGAGTTATGTATGTGGCTCCATAGAGCCCTTCAAGAAACTG
GAGTACACCAAGAATGTGAACCCCAACTGGTCGGTGAACGTCAAGACCACCTCGGCTTCT
CGGGCAGTGTCTTCACTGGCCACTGCCAAAGGAAGCCCTTCAGAGGTGCGAGAGAATAAG
GATTTCATTCGGCCCAAGCTGGTCACCATCATCAGAAGTGGCGTGAAGCCACGGAAAGCT
GTCAGGATTCTGCTGAACAAGAAAACGGCTCATTCCTTTGAGCAGGTCCTCACCGATATC
ACCGATGCCATCAAGCTGGACTCGGGAGTGGTGAAACGCCTGTACACGTTGGATGGGAAA
CAGGTGATGTGCCTTCAGGACTTTTTTGGTGATGATGACATTTTTATTGCATGTGGACCG
GAGAAGTTCCGTTACCAGGATGATTTCTTGCTAGATGAAAGTGAATGTCGAGTGGTAAAG
TCCACTTCTTACACCAAAATAGCTTCATCATCCCGCAGGAGCACCACCAAGAGCCCAGGA
CCGTCCAGGCGTAGCAAGTCCCCTGCCTCCACCAGCTCAGTTAATGGAACCCCTGGTAGT
CAGCTCTCTACTCCGCGCTCAGGCAAGTCGCCAAGCCCATCACCCACCAGCCCAGGAAGC
CTGCGGAAGCAGAGGAGCTCTCAGCATGGCGGCTCCTCTACGTCACTTGCGTCCACCAAA
GTCTGCAGCTCGATGGATGAGAACGATGGCCCTGGAGAAGAAGTGTCGGAGGAAGGCTTC
CAGATTCCAGCTACAATAACAGAACGATATAAAGTCGGAAGAACAATAGGAGATGGAAAT
TTTGCTGTTGTCAAGGAATGTGTAGAAAGATCGACTGCTAGAGAGTATGCTCTGAAAATT
ATCAAGAAAAGCAAATGTCGAGGCAAAGAGCACATGATCCAGAATGAAGTGTCTATTTTA
AGAAGAGTGAAGCATCCCAATATCGTTCTTCTGATTGAGGAGATGGATGTGCCAACTGAA
CTGTATCTTGTCATGGAATTAGTAAAGGGGGGAGACCTTTTTGATGCCATTACTTCCACT
AACAAATACACCGAGAGAGACGCCAGTGGGATGCTGTACAACCTAGCCAGCGCCATCAAA
TACCTGCATAGCCTGAACATCGTCCACCGTGATATCAAGCCAGAGAACCTGCTGGTGTAT
GAGCACCAAGATGGCAGCAAATCACTGAAGCTGGGTGACTTTGGACTGGCCACCATTGTA
GACGGCCCCCTGTACACAGTCTGTGGCACCCCAACATACGTGGCTCCAGAAATCATTGCA
GAGACTGGATACGGCCTCAAGGTGGACATCTGGGCAGCAGGTGTAATCACTTATATCCTG
CTGTGTGGTTTCCCTCCATTCCGTGGAAGTGGTGATGACCAGGAGGTGCTTTTTGATCAG
ATTTTGATGGGGCAGGTGGACTTTCCTTCTCCATACTGGGATAATGTTTCCGATTCTGCA
AAGGAGCTCATTACCATGATGCTGTTGGTCGATGTAGATCAGCGATTTTCTGCTGTTCAA
GTACTTGAGCATCCCTGGGTTAATGATGATGGCCTCCCAGAAAATGAACATCAGCTGTCA
GTAGCTGGAAAGATAAAGAAGCATTTCAACACAGGCCCCAAGCCGAATAGCACAGCAGCT
GGAGTTTCTGTCATAGCACTGGACCACGGGTTTACCATCAAGAGATCAGGGTCTTTGGAC
TACTACCAGCAACCAGGAATGTATTGGATAAGACCACCGCTCTTGATAAGGAGAGGCAGG
TTTTCCGACGAAGACGCAACCAGGATGTGA
Protein Properties
Number of Residues 740
Molecular Weight 82223.2
Theoretical pI 8.91
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Serine/threonine-protein kinase DCLK1
MSFGRDMELEHFDERDKAQRYSRGSRVNGLPSPTHSAHCSFYRTRTLQTLSSEKKAKKVR
FYRNGDRYFKGIVYAISPDRFRSFEALLADLTRTLSDNVNLPQGVRTIYTIDGLKKISSL
DQLVEGESYVCGSIEPFKKLEYTKNVNPNWSVNVKTTSASRAVSSLATAKGSPSEVRENK
DFIRPKLVTIIRSGVKPRKAVRILLNKKTAHSFEQVLTDITDAIKLDSGVVKRLYTLDGK
QVMCLQDFFGDDDIFIACGPEKFRYQDDFLLDESECRVVKSTSYTKIASSSRRSTTKSPG
PSRRSKSPASTSSVNGTPGSQLSTPRSGKSPSPSPTSPGSLRKQRSSQHGGSSTSLASTK
VCSSMDENDGPGEEVSEEGFQIPATITERYKVGRTIGDGNFAVVKECVERSTAREYALKI
IKKSKCRGKEHMIQNEVSILRRVKHPNIVLLIEEMDVPTELYLVMELVKGGDLFDAITST
NKYTERDASGMLYNLASAIKYLHSLNIVHRDIKPENLLVYEHQDGSKSLKLGDFGLATIV
DGPLYTVCGTPTYVAPEIIAETGYGLKVDIWAAGVITYILLCGFPPFRGSGDDQEVLFDQ
ILMGQVDFPSPYWDNVSDSAKELITMMLLVDVDQRFSAVQVLEHPWVNDDGLPENEHQLS
VAGKIKKHFNTGPKPNSTAAGVSVIATTALDKERQVFRRRRNQDVRSRYKAQPAPPELNS
ESEDYSPSSSETVRSPNSPF
GenBank ID Protein 4758128
UniProtKB/Swiss-Prot ID O15075
UniProtKB/Swiss-Prot Entry Name DCLK1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_004734
GeneCard ID DCLK1
GenAtlas ID DCLK1
HGNC ID HGNC:2700
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  4. Dunham A, Matthews LH, Burton J, Ashurst JL, Howe KL, Ashcroft KJ, Beare DM, Burford DC, Hunt SE, Griffiths-Jones S, Jones MC, Keenan SJ, Oliver K, Scott CE, Ainscough R, Almeida JP, Ambrose KD, Andrews DT, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Bannerjee R, Barlow KF, Bates K, Beasley H, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burrill W, Carder C, Carter NP, Chapman JC, Clamp ME, Clark SY, Clarke G, Clee CM, Clegg SC, Cobley V, Collins JE, Corby N, Coville GJ, Deloukas P, Dhami P, Dunham I, Dunn M, Earthrowl ME, Ellington AG, Faulkner L, Frankish AG, Frankland J, French L, Garner P, Garnett J, Gilbert JG, Gilson CJ, Ghori J, Grafham DV, Gribble SM, Griffiths C, Hall RE, Hammond S, Harley JL, Hart EA, Heath PD, Howden PJ, Huckle EJ, Hunt PJ, Hunt AR, Johnson C, Johnson D, Kay M, Kimberley AM, King A, Laird GK, Langford CJ, Lawlor S, Leongamornlert DA, Lloyd DM, Lloyd C, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, McLaren SJ, McMurray A, Milne S, Moore MJ, Nickerson T, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter KM, Rice CM, Searle S, Sehra HK, Shownkeen R, Skuce CD, Smith M, Steward CA, Sycamore N, Tester J, Thomas DW, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Wilming L, Wray PW, Wright MW, Young L, Coulson A, Durbin R, Hubbard T, Sulston JE, Beck S, Bentley DR, Rogers J, Ross MT: The DNA sequence and analysis of human chromosome 13. Nature. 2004 Apr 1;428(6982):522-8. [PubMed:15057823 ]
  5. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  6. Nagase T, Ishikawa K, Nakajima D, Ohira M, Seki N, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro. DNA Res. 1997 Apr 28;4(2):141-50. [PubMed:9205841 ]
  7. Leong WF, Chow VT: Transcriptomic and proteomic analyses of rhabdomyosarcoma cells reveal differential cellular gene expression in response to enterovirus 71 infection. Cell Microbiol. 2006 Apr;8(4):565-80. [PubMed:16548883 ]
  8. Omori Y, Suzuki M, Ozaki K, Harada Y, Nakamura Y, Takahashi E, Fujiwara T: Expression and chromosomal localization of KIAA0369, a putative kinase structurally related to Doublecortin. J Hum Genet. 1998;43(3):169-77. [PubMed:9747029 ]
  9. Sossey-Alaoui K, Srivastava AK: DCAMKL1, a brain-specific transmembrane protein on 13q12.3 that is similar to doublecortin (DCX). Genomics. 1999 Feb 15;56(1):121-6. [PubMed:10036192 ]
  10. Matsumoto N, Pilz DT, Ledbetter DH: Genomic structure, chromosomal mapping, and expression pattern of human DCAMKL1 (KIAA0369), a homologue of DCX (XLIS). Genomics. 1999 Mar 1;56(2):179-83. [PubMed:10051403 ]