You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01375
Secondary Accession Numbers
  • 6671
Name Non-receptor tyrosine-protein kinase TYK2
Synonyms Not Available
Gene Name TYK2
Protein Type Enzyme
Biological Properties
General Function Involved in protein kinase activity
Specific Function Probably involved in intracellular signal transduction by being involved in the initiation of type I IFN signaling. Phosphorylates the interferon-alpha/beta receptor alpha chain
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
cytoskeleton
organelle
non-membrane-bounded organelle
intracellular non-membrane-bounded organelle
Function
protein tyrosine kinase activity
non-membrane spanning protein tyrosine kinase activity
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein binding
protein kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
signaling process
signal transmission
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
signal transmission via phosphorylation event
intracellular protein kinase cascade
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 19p13.2
SNPs TYK2
Gene Sequence
>3564 bp
ATGCCTCTGCGCCACTGGGGGATGGCCAGGGGCAGTAAGCCCGTTGGGGATGGAGCCCAG
CCCATGGCTGCCATGGGAGGCCTGAAGGTGCTTCTGCACTGGGCTGGTCCAGGCGGCGGG
GAGCCCTGGGTCACTTTCAGTGAGTCATCGCTGACAGCTGAGGAAGTCTGCATCCACATT
GCACATAAAGTTGGTATCACTCCTCCTTGCTTCAATCTCTTTGCCCTCTTCGATGCTCAG
GCCCAAGTCTGGTTGCCCCCAAACCACATCCTAGAGATCCCCAGAGATGCAAGCCTGATG
CTATATTTCCGCATAAGGTTTTATTTCCGGAACTGGCATGGCATGAATCCTCGGGAACCG
GCTGTGTACCGTTGTGGGCCCCCAGGAACCGAGGCATCCTCAGATCAGACAGCACAGGGG
ATGCAACTCCTGGACCCAGCCTCATTTGAGTACCTCTTTGAGCAGGGCAAGCATGAGTTT
GTGAATGACGTGGCATCACTGTGGGAGCTGTCGACCGAGGAGGAGATCCACCACTTTAAG
AATGAGAGCCTGGGCATGGCCTTTCTGCACCTCTGTCACCTCGCTCTCCGCCATGGCATC
CCCCTGGAGGAGGTGGCCAAGAAGACCAGCTTCAAGGACTGCATCCCGCGCTCCTTCCGC
CGGCATATCCGGCAGCACAGCGCCCTGACCCGGCTGCGCCTTCGGAACGTCTTCCGCAGG
TTCCTGCGGGACTTCCAGCCGGGCCGACTCTCCCAGCAGATGGTCATGGTCAAATACCTA
GCCACACTCGAGCGGCTGGCACCCCGCTTCGGCACAGAGCGTGTGCCCGTGTGCCACCTG
AGGCTGCTGGCCCAGGCCGAGGGGGAGCCCTGCTACATCCGGGACAGTGGGGTGGCCCCT
ACAGACCCTGGCCCTGAGTCTGCTGCTGGGCCCCCAACCCACGAGGTGCTGGTGACAGGC
ACTGGTGGCATCCAGTGGTGGCCAGTAGAGGAGGAGGTGAACAAGGAGGAGGGTTCTAGT
GGCAGCAGTGGCAGGAACCCCCAAGCCAGCCTGTTTGGGAAGAAGGCCAAGGCTCACAAG
GCATTCGGCCAGCCGGCAGACAGGCCGCGGGAGCCACTGTGGGCCTACTTCTGTGACTTC
CGGGACATCACCCACGTGGTGCTGAAAGAGCACTGTGTCAGCATCCACCGGCAGGACAAC
AAGTGCCTGGAGCTGAGCTTGCCTTCCCGGGCTGCGGCGCTGTCCTTCGTGTCGCTGGTG
GACGGCTATTTCCGCCTGACGGCCGACTCCAGCCACTACCTGTGCCACGAGGTGGCTCCC
CCACGGCTGGTGATGAGCATCCGGGATGGGATCCACGGACCCCTGCTGGAGCCATTTGTG
CAGGCCAAGCTGCGGCCCGAGGACGGCCTGTACCTCATTCACTGGAGCACCAGCCACCCC
TACCGCCTGATCCTCACAGTGGCCCAGCGTAGCCAGGCACCAGACGGCATGCAGAGCTTG
CGGCTCCGAAAGTTCCCCATTGAGCAGCAGGACGGGGCCTTCGTGCTGGAGGGCTGGGGC
CGGTCCTTCCCCAGCGTTCGGGAACTTGGGGCTGCCTTGCAGGGCTGCTTGCTGAGGGCC
GGGGATGACTGCTTCTCTCTGCGTCGCTGTTGCCTGCCCCAACCAGGAGAAACCTCCAAT
CTCATCATCATGCGGGGGGCTCGGGCCAGCCCCAGGACACTCAACCTCAGCCAGCTCAGC
TTCCACCGGGTTGACCAGAAGGAGATCACCCAGCTGTCCCACTTGGGCCAGGGCACAAGG
ACCAACGTGTATGAGGGCCGCCTGCGAGTGGAGGGCAGCGGGGACCCTGAGGAGGGCAAG
ATGGATGACGAGGACCCCCTCGTGCCTGGCAGGGACCGTGGGCAGGAGCTACGAGTGGTG
CTCAAAGTGCTGGACCCTAGTCACCATGACATCGCCCTGGCCTTCTACGAGACAGCCAGC
CTCATGAGCCAGGTCTCCCACACGCACCTGGCCTTCGTGCATGGCGTCTGTGTGCGCGGC
CCTGAAAATAGCATGGTGACAGAGTACGTGGAGCACGGACCCCTGGATGTGTGGCTGCGG
AGGGAGCGGGGCCATGTGCCCATGGCTTGGAAGATGGTGGTGGCCCAGCAGCTGGCCAGC
GCCCTCAGCTACCTGGAGAACAAGAACCTGGTTCATGGTAATGTGTGTGGCCGGAACATC
CTGCTGGCCCGGCTGGGGTTGGCAGAGGGCACCAGCCCCTTCATCAAGCTGAGTGATCCT
GGCGTGGGCCTGGGCGCCCTCTCCAGGGAGGAGCGGGTGGAGAGGATCCCCTGGCTGGCC
CCCGAATGCCTACCAGGTGGGGCCAACAGCCTAAGCACCGCCATGGACAAGTGGGGGTTT
GGCGCCACCCTCCTGGAGATCTGCTTTGACGGAGAGGCCCCTCTGCAGAGCCGCAGTCCC
TCCGAGAAGGAGCATTTCTACCAGAGGCAGCACCGGCTGCCCGAGCCCTCCTGCCCACAG
CTGGCCACACTCACCAGCCAGTGTCTGACCTATGAGCCAACCCAGAGGCCATCATTCCGC
ACCATCCTGCGTGACCTCACCCGCGTGCAGCCCCACAATCTTGCTGACGTCTTGACTGTG
AACCGGGACTCACCGGCCGTCGGACCTACTACTTTCCACAAGCGCTATTTGAAAAAGATC
CGAGATCTGGGCGAGGGTCACTTCGGCAAGGTCAGCTTGTACTGCTACGATCCGACCAAC
GACGGCACTGGCGAGATGGTGGCGGTGAAAGCCCTCAAGGCAGACTGCGGCCCCCAGCAC
CGCTCGGGCTGGAAGCAGGAGATTGACATTCTGCGCACGCTCTACCACGAGCACATCATC
AAGTACAAGGGCTGCTGCGAGGACCAAGGCGAGAAGTCGCTGCAGCTGGTCATGGAGTAC
GTGCCCCTGGGCAGCCTCCGAGACTACCTGCCCCGGCACAGCATCGGGCTGGCCCAGCTG
CTGCTCTTCGCCCAGCAGATCTGCGAGGGCATGGCCTATCTGCACGCGCACGACTACATC
CACCGAGACCTAGCCGCGCGCAACGTGCTGCTGGACAACGACAGGCTGGTCAAGATCGGG
GACTTTGGCCTAGCCAAGGCCGTGCCCGAAGGCCACGAGTACTACCGCGTGCGCGAGGAT
GGGGACAGCCCCGTGTTCTGGTATGCCCCAGAGTGCCTGAAGGAGTATAAGTTCTACTAT
GCGTCAGATGTCTGGTCCTTCGGGGTGACCCTGTATGAGCTGCTGACGCACTGTGACTCC
AGCCAGAGCCCCCCCACGAAATTCCTTGAGCTCATAGGCATTGCTCAGGGTCAGATGACA
GTTCTGAGACTCACTGAGTTGCTGGAACGAGGGGAGAGGCTGCCACGGCCCGACAAATGT
CCCTGTGAGGTCTATCATCTCATGAAGAACTGCTGGGAGACAGAGGCGTCCTTTCGCCCA
ACCTTCGAGAACCTCATACCCATTCTGAAGACAGTCCATGAGAAGTACCAAGGCCAGGCC
CCTTCAGTGTTCAGCGTGTGCTGA
Protein Properties
Number of Residues 1187
Molecular Weight 133648.8
Theoretical pI 7.15
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Non-receptor tyrosine-protein kinase TYK2
MPLRHWGMARGSKPVGDGAQPMAAMGGLKVLLHWAGPGGGEPWVTFSESSLTAEEVCIHI
AHKVGITPPCFNLFALFDAQAQVWLPPNHILEIPRDASLMLYFRIRFYFRNWHGMNPREP
AVYRCGPPGTEASSDQTAQGMQLLDPASFEYLFEQGKHEFVNDVASLWELSTEEEIHHFK
NESLGMAFLHLCHLALRHGIPLEEVAKKTSFKDCIPRSFRRHIRQHSALTRLRLRNVFRR
FLRDFQPGRLSQQMVMVKYLATLERLAPRFGTERVPVCHLRLLAQAEGEPCYIRDSGVAP
TDPGPESAAGPPTHEVLVTGTGGIQWWPVEEEVNKEEGSSGSSGRNPQASLFGKKAKAHK
AVGQPADRPREPLWAYFCDFRDITHVVLKEHCVSIHRQDNKCLELSLPSRAAALSFVSLV
DGYFRLTADSSHYLCHEVAPPRLVMSIRDGIHGPLLEPFVQAKLRPEDGLYLIHWSTSHP
YRLILTVAQRSQAPDGMQSLRLRKFPIEQQDGAFVLEGWGRSFPSVRELGAALQGCLLRA
GDDCFSLRRCCLPQPGETSNLIIMRGARASPRTLNLSQLSFHRVDQKEITQLSHLGQGTR
TNVYEGRLRVEGSGDPEEGKMDDEDPLVPGRDRGQELRVVLKVLDPSHHDIALAFYETAS
LMSQVSHTHLAFVHGVCVRGPENIMVTEYVEHGPLDVWLRRERGHVPMAWKMVVAQQLAS
ALSYLENKNLVHGNVCGRNILLARLGLAEGTSPFIKLSDPGVGLGALSREERVERIPWLA
PECLPGGANSLSTAMDKWGFGATLLEICFDGEAPLQSRSPSEKEHFYQRQHRLPEPSCPQ
LATLTSQCLTYEPTQRPSFRTILRDLTRLQPHNLADVLTVNPDSPASDPTVFHKRYLKKI
RDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADCGPQHRSGWKQEIDILRTLYHEHII
KYKGCCEDQGEKSLQLVMEYVPLGSLRDYLPRHSIGLAQLLLFAQQICEGMAYLHAQHYI
HRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKEYKFYY
ASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGIAQGQMTVLRLTELLERGERLPRPDKC
PCEVYHLMKNCWETEASFRPTFENLIPILKTVHEKYQGQAPSVFSVC
GenBank ID Protein 37504
UniProtKB/Swiss-Prot ID P29597
UniProtKB/Swiss-Prot Entry Name TYK2_HUMAN
PDB IDs Not Available
GenBank Gene ID X54637
GeneCard ID TYK2
GenAtlas ID TYK2
HGNC ID HGNC:12440
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  3. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  4. Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ: Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer. Cell. 2007 Dec 14;131(6):1190-203. [PubMed:18083107 ]
  5. Heibeck TH, Ding SJ, Opresko LK, Zhao R, Schepmoes AA, Yang F, Tolmachev AV, Monroe ME, Camp DG 2nd, Smith RD, Wiley HS, Qian WJ: An extensive survey of tyrosine phosphorylation revealing new sites in human mammary epithelial cells. J Proteome Res. 2009 Aug;8(8):3852-61. doi: 10.1021/pr900044c. [PubMed:19534553 ]
  6. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  7. Partanen J, Makela TP, Alitalo R, Lehvaslaiho H, Alitalo K: Putative tyrosine kinases expressed in K-562 human leukemia cells. Proc Natl Acad Sci U S A. 1990 Nov;87(22):8913-7. [PubMed:2247464 ]
  8. Steindler C, Li Z, Algarte M, Alcover A, Libri V, Ragimbeau J, Pellegrini S: Jamip1 (marlin-1) defines a family of proteins interacting with janus kinases and microtubules. J Biol Chem. 2004 Oct 8;279(41):43168-77. Epub 2004 Jul 23. [PubMed:15277531 ]
  9. Firmbach-Kraft I, Byers M, Shows T, Dalla-Favera R, Krolewski JJ: tyk2, prototype of a novel class of non-receptor tyrosine kinase genes. Oncogene. 1990 Sep;5(9):1329-36. [PubMed:2216457 ]
  10. Velazquez L, Fellous M, Stark GR, Pellegrini S: A protein tyrosine kinase in the interferon alpha/beta signaling pathway. Cell. 1992 Jul 24;70(2):313-22. [PubMed:1386289 ]
  11. Krolewski JJ, Lee R, Eddy R, Shows TB, Dalla-Favera R: Identification and chromosomal mapping of new human tyrosine kinase genes. Oncogene. 1990 Mar;5(3):277-82. [PubMed:2156206 ]
  12. Colamonici O, Yan H, Domanski P, Handa R, Smalley D, Mullersman J, Witte M, Krishnan K, Krolewski J: Direct binding to and tyrosine phosphorylation of the alpha subunit of the type I interferon receptor by p135tyk2 tyrosine kinase. Mol Cell Biol. 1994 Dec;14(12):8133-42. [PubMed:7526154 ]
  13. Minegishi Y, Saito M, Morio T, Watanabe K, Agematsu K, Tsuchiya S, Takada H, Hara T, Kawamura N, Ariga T, Kaneko H, Kondo N, Tsuge I, Yachie A, Sakiyama Y, Iwata T, Bessho F, Ohishi T, Joh K, Imai K, Kogawa K, Shinohara M, Fujieda M, Wakiguchi H, Pasic S, Abinun M, Ochs HD, Renner ED, Jansson A, Belohradsky BH, Metin A, Shimizu N, Mizutani S, Miyawaki T, Nonoyama S, Karasuyama H: Human tyrosine kinase 2 deficiency reveals its requisite roles in multiple cytokine signals involved in innate and acquired immunity. Immunity. 2006 Nov;25(5):745-55. [PubMed:17088085 ]