Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01381
Secondary Accession Numbers
  • 6677
Name Calcium/calmodulin-dependent protein kinase type IV
Synonyms
  1. CaM kinase-GR
  2. CaMK IV
Gene Name CAMK4
Protein Type Unknown
Biological Properties
General Function Involved in calmodulin-dependent protein kinase activity
Specific Function Calcium/calmodulin-dependent protein kinase belonging to a proposed calcium-triggered signaling cascade. May be involved in transcriptional regulation. May be involved in regulation of microtubule dynamics. In vitro, phosphorylates CREB1, CREBBP, PRM2, MEF2A, MEF2D and STMN1/OP18. May be involved in spermatogenesis. May play a role in the consolidation/retention of hippocampus-dependent long-term memory
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular part
cytoplasm
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
calmodulin binding
protein binding
protein kinase activity
protein serine/threonine kinase activity
calmodulin-dependent protein kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location
  1. Nucleus
  2. Cytoplasm
Gene Properties
Chromosome Location Chromosome:5
Locus 5q21.3
SNPs CAMK4
Gene Sequence
>1422 bp
ATGCTCAAAGTCACGGTGCCCTCCTGCTCCGCCTCGTCCTGCTCTTCGGTCACCGCCAGT
GCGGCCCCGGGGACCGCGAGCCTCGTCCCGGATTACTGGATCGACGGCTCCAACAGGGAT
GCGCTGAGCGATTTCTTCGAGGTGGAGTCGGAGCTGGGACGGGGTGCTACATCCATTGTG
TACAGATGCAAACAGAAGGGGACCCAGAAGCCTTATGCTCTCAAAGTGTTAAAGAAAACA
GTGGACAAAAAAATCGTAAGAACTGAGATAGGAGTTCTTCTTCGCCTCTCACATCCAAAC
ATTATAAAACTTAAAGAGATATTTGAAACCCCTACAGAAATCAGTCTGGTCCTAGAACTC
GTCACAGGAGGAGAACTGTTTGATAGGATTGTGGAAAAGGGATATTACAGTGAGCGAGAT
GCTGCAGATGCCGTTAAACAAATCCTGGAGGCAGTTGCTTATCTACATGAAAATGGGATT
GTCCATCGTGATCTCAAACCAGAGAATCTTCTTTATGCAACTCCAGCCCCAGATGCACCA
CTCAAAATCGCTGATTTTGGACTCTCTAAAATTGTGGAACATCAAGTGCTCATGAAGACA
GTATGTGGAACCCCAGGGTACTGCGCACCTGAAATTCTTAGAGGTTGTGCCTATGGACCT
GAGGTGGACATGTGGTCTGTAGGAATAATCACCTACATCTTACTTTGTGGATTTGAACCA
TTCTATGATGAAAGAGGCGATCAGTTCATGTTCAGGAGAATTCTGAATTGTGAATATTAC
TTTATCTCCCCCTGGTGGGATGAAGTATCTCTAAATGCCAAGGACTTGGTCAGAAAATTA
ATTGTTTTGGATCCAAAGAAACGGCTGACTACATTTCAAGCTCTCCAGCATCCGTGGGTC
ACAGGTAAAGCAGCCAATTTTGTACACATGGATACCGCTCAAAAGAAGCTCCAAGAATTC
AATGCCCGGCGTAAGCTTAAGGCAGCGGTGAAGGCTGTGGTGGCCTCTTCCCGCCTGGGA
AGTGCCAGCAGCAGCCATGGCAGCATCCAGGAGAGCCACAAGGCTAGCCGAGACCCTTCT
CCAATCCAAGATGGCAACGAGGACATGAAAGCTATTCCAGAAGGAGAGAAAATTCAAGGC
GATGGGGCCCAAGCCGCAGTTAAGGGGGCACAGGCTGAGCTGATGAAGGTGCAAGCCTTA
GAGAAAGTTAAAGGTGCAGATATAAATGCTGAAGAGGCCCCCAAAATGGTGCCCAAGGCA
GTGGAGGATGGGATAAAGGTGGCTGACCTGGAACTAGAGGAGGGCCTAGCAGAGGAGAAG
CTGAAGACTGTGGAGGAGGCAGCAGCTCCCAGAGAAGGGCAAGGAAGCTCTGCTGTGGGT
TTTGAAGTTCCACAGCAAGATGTGATCCTGCCAGAGTACTAA
Protein Properties
Number of Residues 473
Molecular Weight 51925.0
Theoretical pI 5.58
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Calcium/calmodulin-dependent protein kinase type IV
MLKVTVPSCSASSCSSVTASAAPGTASLVPDYWIDGSNRDALSDFFEVESELGRGATSIV
YRCKQKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLEL
VTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAP
LKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEP
FYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVRKLIVLDPKKRLTTFQALQHPWV
TGKAANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSSHGSIQESHKASRDPS
PIQDGNEDMKAIPEGEKIQGDGAQAAVKGAQAELMKVQALEKVKGADINAEEAPKMVPKA
VEDGIKVADLELEEGLAEEKLKTVEEAAAPREGQGSSAVGFEVPQQDVILPEY
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q16566
UniProtKB/Swiss-Prot Entry Name KCC4_HUMAN
PDB IDs Not Available
GenBank Gene ID D30742
GeneCard ID CAMK4
GenAtlas ID CAMK4
HGNC ID HGNC:1464
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  3. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  4. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  5. Wissing J, Jansch L, Nimtz M, Dieterich G, Hornberger R, Keri G, Wehland J, Daub H: Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry. Mol Cell Proteomics. 2007 Mar;6(3):537-47. Epub 2006 Dec 27. [PubMed:17192257 ]
  6. Kitani T, Okuno S, Fujisawa H: cDNA cloning and expression of human calmodulin-dependent protein kinase IV. J Biochem. 1994 Apr;115(4):637-40. [PubMed:8089075 ]
  7. Bland MM, Monroe RS, Ohmstede CA: The cDNA sequence and characterization of the Ca2+/calmodulin-dependent protein kinase-Gr from human brain and thymus. Gene. 1994 May 16;142(2):191-7. [PubMed:8194751 ]
  8. Mosialos G, Hanissian SH, Jawahar S, Vara L, Kieff E, Chatila TA: A Ca2+/calmodulin-dependent protein kinase, CaM kinase-Gr, expressed after transformation of primary human B lymphocytes by Epstein-Barr virus (EBV) is induced by the EBV oncogene LMP1. J Virol. 1994 Mar;68(3):1697-705. [PubMed:8107230 ]
  9. Chatila T, Anderson KA, Ho N, Means AR: A unique phosphorylation-dependent mechanism for the activation of Ca2+/calmodulin-dependent protein kinase type IV/GR. J Biol Chem. 1996 Aug 30;271(35):21542-8. [PubMed:8702940 ]
  10. Melander Gradin H, Marklund U, Larsson N, Chatila TA, Gullberg M: Regulation of microtubule dynamics by Ca2+/calmodulin-dependent kinase IV/Gr-dependent phosphorylation of oncoprotein 18. Mol Cell Biol. 1997 Jun;17(6):3459-67. [PubMed:9154845 ]
  11. Blaeser F, Ho N, Prywes R, Chatila TA: Ca(2+)-dependent gene expression mediated by MEF2 transcription factors. J Biol Chem. 2000 Jan 7;275(1):197-209. [PubMed:10617605 ]
  12. Takai N, Miyazaki T, Nishida M, Nasu K, Miyakawa I: Ca(2+)/calmodulin-dependent protein kinase IV expression in epithelial ovarian cancer. Cancer Lett. 2002 Sep 26;183(2):185-93. [PubMed:12065094 ]
  13. Anderson KA, Noeldner PK, Reece K, Wadzinski BE, Means AR: Regulation and function of the calcium/calmodulin-dependent protein kinase IV/protein serine/threonine phosphatase 2A signaling complex. J Biol Chem. 2004 Jul 23;279(30):31708-16. Epub 2004 May 13. [PubMed:15143065 ]