Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01384
Secondary Accession Numbers
  • 6680
Name Glycogen synthase kinase-3 alpha
Synonyms
  1. GSK-3 alpha
Gene Name GSK3A
Protein Type Enzyme
Biological Properties
General Function Involved in protein kinase activity
Specific Function Implicated in the hormonal control of several regulatory proteins including glycogen synthase, MYB and the transcription factor JUN
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein kinase activity
protein serine/threonine kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 19q13.2
SNPs GSK3A
Gene Sequence
>1452 bp
ATGAGCGGCGGCGGGCCTTCGGGAGGCGGCCCTGGGGGCTCGGGCAGGGCGCGGACTAGC
TCGTTCGCGGAGCCCGGCGGCGGAGGCGGAGGAGGCGGCGGCGGCCCCGGAGGCTCGGCC
TCCGGCCCAGGCGGCACCGGCGGCGGAAAGGCATCTGTCGGGGCCATGGGTGGGGGCGTC
GGGGCCTCGAGCTCCGGGGGTGGACCCGGCGGCAGCGGCGGAGGAGGCAGCGGAGGCCCC
GGCGCAGGCACTAGCTTCCCGCCGCCCGGGGTGAAGCTGGGCCGTGACAGCGGGAAGGTG
ACCACAGTCGTAGCCACTCTAGGCCAAGGCCCAGAGCGCTCCCAAGAAGTGGCTTACACG
GACATCAAAGTGATTGGCAATGGCTCATTTGGGGTCGTGTACCAGGCACGGCTGGCAGAG
ACCAGGGAACTAGTCGCCATCAAGAAGGTTCTCCAGGACAAGAGGTTCAAGAACCGAGAG
CTGCAGATCATGCGTAAGCTGGACCACTGCAATATTGTGAGGCTGAGATACTTTTTCTAC
TCCAGTGGCGAGAAGAAAGACGAGCTTTACCTAAATCTGGTGCTGGAATATGTGCCCGAG
ACAGTGTACCGGGTGGCCCGCCACTTCACCAAGGCCAAGTTGACCATCCCTATCCTCTAT
GTCAAGGTGTACATGTACCAGCTCTTCCGCAGCTTGGCCTACATCCACTCCCAGGGCGTG
TGTCACCGCGACATCAAGCCCCAGAACCTGCTGGTGGACCCTGACACTGCTGTCCTCAAG
CTCTGCGATTTTGGCAGTGCAAAGCAGTTGGTCCGAGGGGAGCCCAATGTCTCCTACATC
TGTTCTCGCTACTACCGGGCCCCAGAGCTCATCTTTGGAGCCACTGATTACACCTCATCC
ATCGATGTTTGGTCAGCTGGCTGTGTACTGGCAGAGCTCCTCTTGGGCCAGCCCATCTTC
CCTGGGGACAGTGGGGTGGACCAGCTGGTGGAGATCATCAAGGTGCTGGGAACACCAACC
CGGGAACAAATCCGAGAGATGAACCCCAACTACACGGAGTTCAAGTTCCCTCAGATTAAA
GCTCACCCCTGGACAAAGGTGTTCAAATCTCGAACGCCGCCAGAGGCCATCGCGCTCTGC
TCTAGCCTGCTGGAGTACACCCCATCCTCAAGGCTCTCCCCACTAGAGGCCTGTGCGCAC
AGCTTCTTTGATGAACTGCGATGTCTGGGAACCCAGCTGCCTAACAACCGCCCACTTCCC
CCTCTCTTCAACTTCAGTGCTGGTGAACTCTCCATCCAACCGTCTCTCAACGCCATTCTT
ATCCCTCCTCACTTGAGGTCCCCAGCGGGCACTACCACCCTCACCCCGTCCTCACAAGCT
TTAACTGAGACTCCGACCAGCTCAGACTGGCAGTCGACCGATGCCACACCTACCCTCACT
AACTCCTCCTGA
Protein Properties
Number of Residues 483
Molecular Weight 50980.4
Theoretical pI 8.95
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Glycogen synthase kinase-3 alpha
MSGGGPSGGGPGGSGRARTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGKASVGAMGGGV
GASSSGGGPGGSGGGGSGGPGAGTSFPPPGVKLGRDSGKVTTVVATLGQGPERSQEVAYT
DIKVIGNGSFGVVYQARLAETRELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFY
SSGEKKDELYLNLVLEYVPETVYRVARHFTKAKLTIPILYVKVYMYQLFRSLAYIHSQGV
CHRDIKPQNLLVDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSS
IDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIK
AHPWTKVFKSRTPPEAIALCSSLLEYTPSSRLSPLEACAHSFFDELRCLGTQLPNNRPLP
PLFNFSAGELSIQPSLNAILIPPHLRSPAGTTTLTPSSQALTETPTSSDWQSTDATPTLT
NSS
GenBank ID Protein 4210499
UniProtKB/Swiss-Prot ID P49840
UniProtKB/Swiss-Prot Entry Name GSK3A_HUMAN
PDB IDs Not Available
GenBank Gene ID AC006486
GeneCard ID GSK3A
GenAtlas ID GSK3A
HGNC ID HGNC:4616
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Rush J, Moritz A, Lee KA, Guo A, Goss VL, Spek EJ, Zhang H, Zha XM, Polakiewicz RD, Comb MJ: Immunoaffinity profiling of tyrosine phosphorylation in cancer cells. Nat Biotechnol. 2005 Jan;23(1):94-101. Epub 2004 Dec 12. [PubMed:15592455 ]
  3. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  4. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  5. Zahedi RP, Lewandrowski U, Wiesner J, Wortelkamp S, Moebius J, Schutz C, Walter U, Gambaryan S, Sickmann A: Phosphoproteome of resting human platelets. J Proteome Res. 2008 Feb;7(2):526-34. Epub 2007 Dec 19. [PubMed:18088087 ]
  6. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  7. Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ: Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer. Cell. 2007 Dec 14;131(6):1190-203. [PubMed:18083107 ]
  8. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [PubMed:15057824 ]
  9. Wolf-Yadlin A, Hautaniemi S, Lauffenburger DA, White FM: Multiple reaction monitoring for robust quantitative proteomic analysis of cellular signaling networks. Proc Natl Acad Sci U S A. 2007 Apr 3;104(14):5860-5. Epub 2007 Mar 26. [PubMed:17389395 ]
  10. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  11. Wissing J, Jansch L, Nimtz M, Dieterich G, Hornberger R, Keri G, Wehland J, Daub H: Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry. Mol Cell Proteomics. 2007 Mar;6(3):537-47. Epub 2006 Dec 27. [PubMed:17192257 ]