You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01388
Secondary Accession Numbers
  • 6684
Name Cell division protein kinase 7
Synonyms
  1. 39 kDa protein kinase
  2. CAK
  3. CAK1
  4. CDK-activating kinase
  5. STK1
  6. TFIIH basal transcription factor complex kinase subunit
  7. p39 Mo15
Gene Name CDK7
Protein Type Enzyme
Biological Properties
General Function Involved in protein kinase activity
Specific Function Cyclin-dependent kinases (CDKs) are activated by the binding to a cyclin and mediate the progression through the cell cycle. Each different complex controls a specific transition between two subsequent phases in the cell cycle. CDK7 is the catalytic subunit of the CDK-activating kinase (CAK) complex, a serine-threonine kinase. CAK activates the cyclin-associated kinases CDK1, CDK2, CDK4 and CDK6 by threonine phosphorylation. CAK complexed to the core-TFIIH basal transcription factor activates RNA polymerase II by serine phosphorylation of the repetitive C-terminus domain (CTD) of its large subunit (POLR2A), allowing its escape from the promoter and elongation of the transcripts. Involved in cell cycle control and in RNA transcription by RNA polymerase II. Its expression and activity are constant throughout the cell cycle
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein kinase activity
protein serine/threonine kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location
  1. Nucleus
Gene Properties
Chromosome Location Chromosome:5
Locus 5q12.1
SNPs CDK7
Gene Sequence
>1041 bp
ATGGCTCTGGACGTGAAGTCTCGGGCAAAGCGTTATGAGAAGCTGGACTTCCTTGGGGAG
GGACAGTTTGCCACCGTTTACAAGGCCAGAGATAAGAATACCAACCAAATTGTCGCCATT
AAGAAAATCAAACTTGGACATAGATCAGAAGCTAAAGATGGTATAAATAGAACCGCCTTA
AGAGAGATAAAATTATTACAGGAGCTAAGTCATCCAAATATAATTGGTCTCCTTGATGCT
TTTGGACATAAATCTAATATTAGCCTTGTCTTTGATTTTATGGAAACTGATCTAGAGGTT
ATAATAAAGGATAATAGTCTTGTGCTGACACCATCACACATCAAAGCCTACATGTTGATG
ACTCTTCAAGGATTAGAATATTTACATCAACATTGGATCCTACATAGGGATCTGAAACCA
AACAACTTGTTGCTAGATGAAAATGGAGTTCTAAAACTGGCAGATTTTGGCCTGGCCAAA
TCTTTTGGGAGCCCCAATAGAGCTTATACACATCAGGTTGTAACCAGGTGGTATCGGGCC
CCCGAGTTACTATTTGGAGCTAGGATGTATGGTGTAGGTGTGGACATGTGGGCTGTTGGC
TGTATATTAGCAGAGTTACTTCTAAGGGTTCCTTTTTTGCCAGGAGATTCAGACCTTGAT
CAGCTAACAAGAATATTTGAAACTTTGGGCACACCAACTGAGGAACAGTGGCCGGACATG
TGTAGTCTTCCAGATTATGTGACATTTAAGAGTTTCCCTGGAATACCTTTGCATCACATC
TTCAGTGCAGCAGGAGACGACTTACTAGATCTCATACAAGGCTTATTCTTATTTAATCCA
TGTGCTCGAATTACGGCCACACAGGCACTGAAAATGAAGTATTTCAGTAATCGGCCAGGG
CCAACACCTGGATGTCAGCTGCCAAGACCAAACTGTCCAGTGGAAACCTTAAAGGAGCAA
TCAAATCCAGCTTTGGCAATAAAAAGGAAAAGAACAGAGGCCTTAGAACAAGGAGGATTG
CCCAAGAAACTAATTTTTTAA
Protein Properties
Number of Residues 346
Molecular Weight 39038.0
Theoretical pI 8.68
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Cell division protein kinase 7
MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTAL
REIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLM
TLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRA
PELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDM
CSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPG
PTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF
GenBank ID Protein 485909
UniProtKB/Swiss-Prot ID P50613
UniProtKB/Swiss-Prot Entry Name CDK7_HUMAN
PDB IDs
GenBank Gene ID X79193
GeneCard ID CDK7
GenAtlas ID CDK7
HGNC ID HGNC:1778
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  4. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  5. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  6. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  7. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  8. Kershnar E, Wu SY, Chiang CM: Immunoaffinity purification and functional characterization of human transcription factor IIH and RNA polymerase II from clonal cell lines that conditionally express epitope-tagged subunits of the multiprotein complexes. J Biol Chem. 1998 Dec 18;273(51):34444-53. [PubMed:9852112 ]
  9. Wissing J, Jansch L, Nimtz M, Dieterich G, Hornberger R, Keri G, Wehland J, Daub H: Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry. Mol Cell Proteomics. 2007 Mar;6(3):537-47. Epub 2006 Dec 27. [PubMed:17192257 ]
  10. Levedakou EN, He M, Baptist EW, Craven RJ, Cance WG, Welcsh PL, Simmons A, Naylor SL, Leach RJ, Lewis TB, et al.: Two novel human serine/threonine kinases with homologies to the cell cycle regulating Xenopus MO15, and NIMA kinases: cloning and characterization of their expression pattern. Oncogene. 1994 Jul;9(7):1977-88. [PubMed:8208544 ]
  11. Tassan JP, Schultz SJ, Bartek J, Nigg EA: Cell cycle analysis of the activity, subcellular localization, and subunit composition of human CAK (CDK-activating kinase). J Cell Biol. 1994 Oct;127(2):467-78. [PubMed:7929589 ]
  12. Darbon JM, Devault A, Taviaux S, Fesquet D, Martinez AM, Galas S, Cavadore JC, Doree M, Blanchard JM: Cloning, expression and subcellular localization of the human homolog of p40MO15 catalytic subunit of cdk-activating kinase. Oncogene. 1994 Nov;9(11):3127-38. [PubMed:7936635 ]
  13. Wu L, Yee A, Liu L, Carbonaro-Hall D, Venkatesan N, Tolo VT, Hall FL: Molecular cloning of the human CAK1 gene encoding a cyclin-dependent kinase-activating kinase. Oncogene. 1994 Jul;9(7):2089-96. [PubMed:8208556 ]
  14. Fisher RP, Morgan DO: A novel cyclin associates with MO15/CDK7 to form the CDK-activating kinase. Cell. 1994 Aug 26;78(4):713-24. [PubMed:8069918 ]
  15. Akoulitchev S, Reinberg D: The molecular mechanism of mitotic inhibition of TFIIH is mediated by phosphorylation of CDK7. Genes Dev. 1998 Nov 15;12(22):3541-50. [PubMed:9832506 ]
  16. Tirode F, Busso D, Coin F, Egly JM: Reconstitution of the transcription factor TFIIH: assignment of functions for the three enzymatic subunits, XPB, XPD, and cdk7. Mol Cell. 1999 Jan;3(1):87-95. [PubMed:10024882 ]
  17. Liu J, He L, Collins I, Ge H, Libutti D, Li J, Egly JM, Levens D: The FBP interacting repressor targets TFIIH to inhibit activated transcription. Mol Cell. 2000 Feb;5(2):331-41. [PubMed:10882074 ]
  18. Lolli G, Lowe ED, Brown NR, Johnson LN: The crystal structure of human CDK7 and its protein recognition properties. Structure. 2004 Nov;12(11):2067-79. [PubMed:15530371 ]