You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01406
Secondary Accession Numbers
  • 6702
Name Serine/threonine-protein kinase LATS2
Synonyms
  1. Kinase phosphorylated during mitosis protein
  2. Large tumor suppressor homolog 2
  3. Serine/threonine-protein kinase kpm
  4. Warts-like kinase
Gene Name LATS2
Protein Type Unknown
Biological Properties
General Function Involved in protein serine/threonine kinase activity
Specific Function Negative regulator of YAP1 in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein MST1/MST2, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Phosphorylation of YAP1 by LATS2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. Acts as a tumor suppressor which plays a critical role in centrosome duplication, maintenance of mitotic fidelity and genomic stability. Negatively regulates G1/S transition by down-regulating cyclin E/CDK2 kinase activity. Negative regulator of the androgen receptor
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein kinase activity
protein serine/threonine kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location
  1. Cytoplasm
  2. Cytoplasm
  3. Cytoplasm
  4. cytoskeleton
  5. cytoskeleton
  6. centrosome
  7. spindle pole
Gene Properties
Chromosome Location Chromosome:1
Locus 13q11-q12
SNPs LATS2
Gene Sequence
>3267 bp
ATGAGGCCAAAGACTTTTCCTGCCACGACTTATTCTGGAAATAGCCGGCAGCGACTGCAA
GAGATTCGTGAGGGGTTAAAACAGCCATCCAAGTCTTCGGTTCAGGGGCTACCCGCAGGA
CCAAACAGTGACACTTCCCTGGATGCCAAAGTCCTGGGGAGCAAAGATGCCACCAGGCAG
CAGCAGCAGATGAGAGCCACCCCAAAGTTCGGACCTTATCAGAAAGCCTTGAGGGAAATC
AGATATTCCTTGTTGCCTTTTGCTAATGAATCGGGCACCTCTGCAGCTGCAGAAGTGAAC
CGGCAAATGCTGCAGGAACTGGTGAACGCAGGATGCGACCAGGAGATGGCTGGCCGAGCT
CTCAAGCAGACTGGCAGCAGGAGCATCGAGGCCGCCCTGGAGTACATCAGCAAGATGGGC
TACCTGGACCCGAGGAATGAGCAGATTGTGCGGGTCATTAAGCAGACCTCCCCAGGAAAG
GGGCTCATGCCAACCCCAGTGACGCGGAGGCCCAGCTTCGAAGGAACCGGCGATTCGTTT
GCGTCCTACCACCAGCTGAGCGGTACCCCCTACGAGGGCCCAAGCTTCGGCGCTGACGGC
CCCACGGCGCTGGAGGAGATGCCGCGGCCGTACGTGGACTACCTTTTCCCCGGAGTCGGC
CCCCACGGGCCCGGCCACCAGCACCAGCACCCACCCAAGGGCTACGGTGCCAGCGTAGAG
GCAGCAGGGGCACACTTCCCGCTGCAGGGCGCGCACTACGGGCGGCCGCACCTGCTGGTG
CCTGGGGAACCCCTGGGCTACGGAGTGCAGCGCAGCCCCTCCTTCCAGAGCAAGACGCCG
CCGGAGACCGGGGGTTACGCCAGCCTGCCCACGAAGGGCCAGGGAGGACCGCCAGGCGCC
GGCCTCGCTTTCCCACCCCCTGCCGCCGGGCTCTACGTGCCGCACCCACACCACAAGCAG
GCCGGTCCCGCGGCCCACCAGCTGCATGTGCTGGGCTCCCGCAGCCAGGTGTTCGCCAGC
GACAGCCCCCCGCAGAGCCTGCTCACTCCCTCGCGGAACAGCCTCAACGTGGACCTGTAT
GAATTGGGCAGCACCTCCGTCCAGCAGTGGCCGGCTGCCACCCTGGCCCGCCGGGACTCC
CTGCAGAAGCCGGGCCTGGAGGCGCCGCCGCGCGCGCACGTGGCCTTCCGGCCTGACTGC
CCAGTGCCCAGCAGGACCAACTCCTTCAACAGCCACCAGCCGCGGCCCGGTCCGCCTGGC
AAGGCCGAGCCCTCCCTGCCCGCCCCCAACACCGTGACGGCTGTCACGGCCGCGCACATC
TTGCACCCGGTGAAGAGCGTGCGTGTGCTGAGGCCGGAGCCGCAGACGGCTGTGGGGCCC
TCGCACCCCGCCTGGGTGCCCGCGCCTGCCCCGGCCCCCGCCCCCGCCCCCGCCCCGGCT
GCGGAGGGCTTGGACGCCAAGGAGGAGCATGCCCTGGCGCTGGGCGGCGCAGGCGCCTTC
CCGCTGGACGTGGAGTACGGAGGCCCAGACCGGAGGTGCCCGCCTCCGCCCTACCCGAAG
CACCTGCTGCTGCGCAGCAAGTCGGAGCAGTACGACCTGGACAGCCTGTGCGCAGGCATG
GAGCAGAGCCTCCGTGCGGGCCCCAACGAGCCCGAGGGCGGCGACAAGAGCCGCAAAAGC
GCCAAGGGGGACAAAGGCGGAAAGGATAAAAAGCAGATTCAGACCTCTCCCGTTCCCGTC
CGCAAAAACAGCAGAGACGAAGAGAAGAGAGAGTCACGCATCAAGAGCTACTCGCCATAC
GCCTTTAAGTTCTTCATGGAGCAGCACGTGGAGAATGTCATCAAAACCTACCAGCAGAAG
GTTAACCGGAGGCTGCAGCTGGAGCAAGAAATGGCCAAAGCTGGACTCTGTGAAGCTGAG
CAGGAGCAGATGCGGAAGATCCTCTACCAGAAAGAGTCTAATTACAACAGGTTAAAGAGG
GCCAAGATGGACAAGTCTATGTTTGTCAAGATCAAAACCCTGGGGATCGGTGCCTTTGGA
GAAGTGTGCCTTGCTTGTAAGGTGGACACTCACGCCCTGTACGCCATGAAGACCCTAAGG
AAAAAGGATGTCCTGAACCGGAATCAGGTGGCCCACGTCAAGGCCGAGAGGGACATCCTG
GCCGAGGCAGACAATGAGTGGGTGGTCAAACTCTACTACTCCTTCCAAGACAAAGACAGC
CTGTACTTTGTGATGGACTACATCCCTGGTGGGGACATGATGAGCCTGCTGATCCGGATG
GAGGTCTTCCCTGAGCACCTGGCCCGGTTCTACATCGCAGAGCTGACTTTGGCCATTGAG
AGTGTCCACAAGATGGGCTTCATCCACCGAGACATCAAGCCTGATAACATTTTGATAGAT
CTGGATGGTCACATTAAACTCACAGATTTCGGCCTCTGCACTGGGTTCAGGTGGACTCAC
AATTCCAAATATTACCAGAAAGGGAGCCATGTCAGACAGGACAGCATGGAGCCCAGCGAC
CTCTGGGATGATGTGTCTAACTGTCGGTGTGGGGACAGGCTGAAGACCCTAGAGCAGAGG
GCGCGGAAGCAGCACCAGAGGTGCCTGGCACATTCACTGGTGGGGACTCCAAACTACATC
GCACCCGAGGTGCTCCTCCGCAAAGGGTACACTCAACTCTGTGACTGGTGGAGTGTTGGA
GTGATTCTCTTCGAGATGCTGGTGGGGCAGCCGCCCTTTTTGGCACCTACTCCCACAGAA
ACCCAGCTGAAGGTGATCAACTGGGAGAACACGCTCCACATTCCAGCCCAGGTGAAGCTG
AGCCCTGAGGCCAGGGACCTCATCACCAAGCTGTGCTGCTCCGCAGACCACCGCCTGGGG
CGGAATGGGGCCGATGACCTGAAGGCCCACCCCTTCTTCAGCGCCATTGACTTCTCCAGT
GACATCCGGAAGCAGCCAGCCCCCTACGTTCCCACCATCAGCCACCCCATGGACACCTCG
AATTTCGACCCCGTAGATGAAGAAAGCCCTTGGAACGATGCCAGCGAAGGTAGCACCAAG
GCCTGGGACACACTCACCTCGCCCAATAACAAGCATCCTGAGCACGCATTTTACGAATTC
ACCTTCCGAAGGTTCTTTGATGACAATGGCTACCCCTTTCGATGCCCAAAGCCTTCAGGA
GCAGAAGCTTCACAGGCTGAGAGCTCAGATTTAGAAAGCTCTGATCTGGTGGATCAGACT
GAAGGCTGCCAGCCTGTGTACGTGTAG
Protein Properties
Number of Residues 1088
Molecular Weight 120134.9
Theoretical pI 8.32
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Serine/threonine-protein kinase LATS2
MRPKTFPATTYSGNSRQRLQEIREGLKQPSKSSVQGLPAGPNSDTSLDAKVLGSKDATRQ
QQQMRATPKFGPYQKALREIRYSLLPFANESGTSAAAEVNRQMLQELVNAGCDQEMAGRA
LKQTGSRSIEAALEYISKMGYLDPRNEQIVRVIKQTSPGKGLMPTPVTRRPSFEGTGDSF
ASYHQLSGTPYEGPSFGADGPTALEEMPRPYVDYLFPGVGPHGPGHQHQHPPKGYGASVE
AAGAHFPLQGAHYGRPHLLVPGEPLGYGVQRSPSFQSKTPPETGGYASLPTKGQGGPPGA
GLAFPPPAAGLYVPHPHHKQAGPAAHQLHVLGSRSQVFASDSPPQSLLTPSRNSLNVDLY
ELGSTSVQQWPAATLARRDSLQKPGLEAPPRAHVAFRPDCPVPSRTNSFNSHQPRPGPPG
KAEPSLPAPNTVTAVTAAHILHPVKSVRVLRPEPQTAVGPSHPAWVPAPAPAPAPAPAPA
AEGLDAKEEHALALGGAGAFPLDVEYGGPDRRCPPPPYPKHLLLRSKSEQYDLDSLCAGM
EQSLRAGPNEPEGGDKSRKSAKGDKGGKDKKQIQTSPVPVRKNSRDEEKRESRIKSYSPY
AFKFFMEQHVENVIKTYQQKVNRRLQLEQEMAKAGLCEAEQEQMRKILYQKESNYNRLKR
AKMDKSMFVKIKTLGIGAFGEVCLACKVDTHALYAMKTLRKKDVLNRNQVAHVKAERDIL
AEADNEWVVKLYYSFQDKDSLYFVMDYIPGGDMMSLLIRMEVFPEHLARFYIAELTLAIE
SVHKMGFIHRDIKPDNILIDLDGHIKLTDFGLCTGFRWTHNSKYYQKGSHVRQDSMEPSD
LWDDVSNCRCGDRLKTLEQRARKQHQRCLAHSLVGTPNYIAPEVLLRKGYTQLCDWWSVG
VILFEMLVGQPPFLAPTPTETQLKVINWENTLHIPAQVKLSPEARDLITKLCCSADHRLG
RNGADDLKAHPFFSAIDFSSDIRKQPAPYVPTISHPMDTSNFDPVDEESPWNDASEGSTK
AWDTLTSPNNKHPEHAFYEFTFRRFFDDNGYPFRCPKPSGAEASQAESSDLESSDLVDQT
EGCQPVYV
GenBank ID Protein 126507091
UniProtKB/Swiss-Prot ID Q9NRM7
UniProtKB/Swiss-Prot Entry Name LATS2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_014572.2
GeneCard ID LATS2
GenAtlas ID LATS2
HGNC ID HGNC:6515
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Dunham A, Matthews LH, Burton J, Ashurst JL, Howe KL, Ashcroft KJ, Beare DM, Burford DC, Hunt SE, Griffiths-Jones S, Jones MC, Keenan SJ, Oliver K, Scott CE, Ainscough R, Almeida JP, Ambrose KD, Andrews DT, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Bannerjee R, Barlow KF, Bates K, Beasley H, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burrill W, Carder C, Carter NP, Chapman JC, Clamp ME, Clark SY, Clarke G, Clee CM, Clegg SC, Cobley V, Collins JE, Corby N, Coville GJ, Deloukas P, Dhami P, Dunham I, Dunn M, Earthrowl ME, Ellington AG, Faulkner L, Frankish AG, Frankland J, French L, Garner P, Garnett J, Gilbert JG, Gilson CJ, Ghori J, Grafham DV, Gribble SM, Griffiths C, Hall RE, Hammond S, Harley JL, Hart EA, Heath PD, Howden PJ, Huckle EJ, Hunt PJ, Hunt AR, Johnson C, Johnson D, Kay M, Kimberley AM, King A, Laird GK, Langford CJ, Lawlor S, Leongamornlert DA, Lloyd DM, Lloyd C, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, McLaren SJ, McMurray A, Milne S, Moore MJ, Nickerson T, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter KM, Rice CM, Searle S, Sehra HK, Shownkeen R, Skuce CD, Smith M, Steward CA, Sycamore N, Tester J, Thomas DW, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Wilming L, Wray PW, Wright MW, Young L, Coulson A, Durbin R, Hubbard T, Sulston JE, Beck S, Bentley DR, Rogers J, Ross MT: The DNA sequence and analysis of human chromosome 13. Nature. 2004 Apr 1;428(6982):522-8. [PubMed:15057823 ]
  4. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  5. Hori T, Takaori-Kondo A, Kamikubo Y, Uchiyama T: Molecular cloning of a novel human protein kinase, kpm, that is homologous to warts/lats, a Drosophila tumor suppressor. Oncogene. 2000 Jun 22;19(27):3101-9. [PubMed:10871863 ]
  6. Yabuta N, Fujii T, Copeland NG, Gilbert DJ, Jenkins NA, Nishiguchi H, Endo Y, Toji S, Tanaka H, Nishimune Y, Nojima H: Structure, expression, and chromosome mapping of LATS2, a mammalian homologue of the Drosophila tumor suppressor gene lats/warts. Genomics. 2000 Jan 15;63(2):263-70. [PubMed:10673337 ]
  7. Li Y, Pei J, Xia H, Ke H, Wang H, Tao W: Lats2, a putative tumor suppressor, inhibits G1/S transition. Oncogene. 2003 Jul 10;22(28):4398-405. [PubMed:12853976 ]
  8. Toji S, Yabuta N, Hosomi T, Nishihara S, Kobayashi T, Suzuki S, Tamai K, Nojima H: The centrosomal protein Lats2 is a phosphorylation target of Aurora-A kinase. Genes Cells. 2004 May;9(5):383-97. [PubMed:15147269 ]
  9. Powzaniuk M, McElwee-Witmer S, Vogel RL, Hayami T, Rutledge SJ, Chen F, Harada S, Schmidt A, Rodan GA, Freedman LP, Bai C: The LATS2/KPM tumor suppressor is a negative regulator of the androgen receptor. Mol Endocrinol. 2004 Aug;18(8):2011-23. Epub 2004 May 6. [PubMed:15131260 ]
  10. Chan EH, Nousiainen M, Chalamalasetty RB, Schafer A, Nigg EA, Sillje HH: The Ste20-like kinase Mst2 activates the human large tumor suppressor kinase Lats1. Oncogene. 2005 Mar 17;24(12):2076-86. [PubMed:15688006 ]
  11. Abe Y, Ohsugi M, Haraguchi K, Fujimoto J, Yamamoto T: LATS2-Ajuba complex regulates gamma-tubulin recruitment to centrosomes and spindle organization during mitosis. FEBS Lett. 2006 Feb 6;580(3):782-8. Epub 2006 Jan 9. [PubMed:16413547 ]
  12. Hao Y, Chun A, Cheung K, Rashidi B, Yang X: Tumor suppressor LATS1 is a negative regulator of oncogene YAP. J Biol Chem. 2008 Feb 29;283(9):5496-509. Epub 2007 Dec 24. [PubMed:18158288 ]
  13. Chow A, Hao Y, Yang X: Molecular characterization of human homologs of yeast MOB1. Int J Cancer. 2010 May 1;126(9):2079-89. doi: 10.1002/ijc.24878. [PubMed:19739119 ]