Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01418
Secondary Accession Numbers
  • 6714
Name Rhodopsin kinase
Synonyms
  1. G protein-coupled receptor kinase 1
  2. RK
Gene Name GRK1
Protein Type Enzyme
Biological Properties
General Function Involved in protein serine/threonine kinase activity
Specific Function Phosphorylates rhodopsin thereby initiating its deactivation
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
g-protein coupled receptor kinase activity
molecular transducer activity
signal transducer activity
protein kinase activity
protein serine/threonine kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
biological regulation
regulation of biological process
cellular metabolic process
regulation of cellular process
signal transduction
protein amino acid phosphorylation
phosphorylation
Cellular Location
  1. Lipid-anchor
  2. Membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 13q34
SNPs GRK1
Gene Sequence
>1692 bp
ATGGATTTCGGGTCTTTGGAGACCGTGGTGGCCAACTCTGCCTTCATCGCCGCCCGAGGC
AGCTTTGACGGCAGCAGCTCCCAACCCTCCCGGGACAAGAAGTACCTGGCCAAGCTCAAG
CTGCCCCCGCTGTCCAAGTGTGAGTCCCTCCGCGACAGCCTCAGCCTGGAGTTTGAGAGT
GTGTGCTTGGAGCAGCCCATCGGCAAGAAGCTCTTTCAGCAGTTCCTACAATCGGCAGAG
AAGCACCTGCCGGCCCTGGAGCTCTGGAAAGACATCGAGGACTATGACACGGCAGACAAT
GACCTCCAGCCACAGAAGGCCCAGACCATCCTGGCCCAGTACCTGGACCCCCAGGCCAAA
CTCTTCTGCAGCTTCCTGGATGAGGGGATAGTGGCGAAGTTTAAGGAGGGGCCTGTGGAG
ATCCAGGACGGGCTCTTCCAGCCCCTGCTGCAGGCCACCCTGGCACACCTGGGCCAAGCC
CCCTTCCAGGAGTACCTGGGCAGCCTGTACTTCCTGAGGTTCCTGCAGTGGAAGTGGCTG
GAAGCCCAGCCCATGGGGGAGGACTGGTTCCTGGACTTCAGGGTCCTGGGGAAAGGGGGC
TTCGGGGAGGTGTCGGCCTGCCAGATGAAGGCGACCGGCAAGCTGTATGCCTGCAAGAAG
CTGAACAAGAAGCGGCTGAAGAAGAGGAAGGGCTACCAGGGTGCTATGGTGGAGAAGAAG
ATTCTGATGAAAGTACACAGCAGGTTCATCGTGTCTCTGGCCTATGCGTTTGAAACCAAA
GCCGACCTCTGTCTGGTGATGACCATCATGAACGGAGGTGACATCAGGTACCACATCTAC
AACGTGAATGAGGAGAACCCTGGCTTCCCGGAGCCGCGCGCCCTCTTCTACACGGCGCAG
ATCATCTGCGGCCTGGAGCACCTGCACCAGAGGCGGATCGTCTACCGCGACCTCAAGCCC
GAGAACGTGCTGCTGGACAATGACGGCAATGTCCGGATCTCTGACCTTGGGCTGGCCGTG
GAGCTGCTGGACGGACAGAGCAAGACCAAGGGCTACGCAGGGACCCCAGGTTTCATGGCC
CCCGAGCTCCTGCAGGGCGAGGAGTACGACTTCTCCGTGGACTACTTTGCCCTGGGGGTC
ACCCTGTATGAGATGATTGCGGCCAGAGGACCCTTCCGAGCCCGTGGAGAGAAGGTGGAG
AACAAGGAGCTGAAGCACCGGATCATCTCAGAGCCCGTGAAGTACCCTGATAAGTTCAGC
CAGGCCAGCAAGGACTTCTGCGAGGCGCTGCTGGAGAAGGACCCGGAGAAGCGCCTGGGG
TTCAGAGATGAGACCTGCGACAAGCTCCGTGCCCACCCCCTCTTCAAGGACCTTAACTGG
AGGCAGCTGGAGGCTGGGATGCTGATGCCCCCTTTCATCCCAGACTCCAAAACTGTCTAC
GCAAAGGATATTCAGGACGTGGGTGCCTTTTCCACCGTCAAAGGTGTGGCCTTTGACAAA
ACAGACACAGAATTCTTTCAGGAATTTGCCACTGGCAACTGCCCCATCCCCTGGCAGGAG
GAGATGATCGAGACGGGCATCTTTGGCGAGCTGAACGTGTGGCGCTCGGACGGTCAGATG
CCGGACGACATGAAGGGCATCTCCGGGGGCTCCAGCTCCTCGTCCAAGTCAGGGATGTGT
CTGGTTTCCTAG
Protein Properties
Number of Residues 563
Molecular Weight 63525.3
Theoretical pI 5.62
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Rhodopsin kinase
MDFGSLETVVANSAFIAARGSFDGSSSQPSRDKKYLAKLKLPPLSKCESLRDSLSLEFES
VCLEQPIGKKLFQQFLQSAEKHLPALELWKDIEDYDTADNDLQPQKAQTILAQYLDPQAK
LFCSFLDEGIVAKFKEGPVEIQDGLFQPLLQATLAHLGQAPFQEYLGSLYFLRFLQWKWL
EAQPMGEDWFLDFRVLGKGGFGEVSACQMKATGKLYACKKLNKKRLKKRKGYQGAMVEKK
ILMKVHSRFIVSLAYAFETKADLCLVMTIMNGGDIRYHIYNVNEENPGFPEPRALFYTAQ
IICGLEHLHQRRIVYRDLKPENVLLDNDGNVRISDLGLAVELLDGQSKTKGYAGTPGFMA
PELLQGEEYDFSVDYFALGVTLYEMIAARGPFRARGEKVENKELKHRIISEPVKYPDKFS
QASKDFCEALLEKDPEKRLGFRDETCDKLRAHPLFKDLNWRQLEAGMLMPPFIPDSKTVY
AKDIQDVGAFSTVKGVAFDKTDTEFFQEFATGNCPIPWQEEMIETGIFGELNVWRSDGQM
PDDMKGISGGSSSSSKSGMCLVS
GenBank ID Protein 158260847
UniProtKB/Swiss-Prot ID Q15835
UniProtKB/Swiss-Prot Entry Name RK_HUMAN
PDB IDs Not Available
GenBank Gene ID AK289912
GeneCard ID GRK1
GenAtlas ID GRK1
HGNC ID HGNC:10013
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Zhao X, Haeseleer F, Fariss RN, Huang J, Baehr W, Milam AH, Palczewski K: Molecular cloning and localization of rhodopsin kinase in the mammalian pineal. Vis Neurosci. 1997 Mar-Apr;14(2):225-32. [PubMed:9147475 ]
  3. Khani SC, Abitbol M, Yamamoto S, Maravic-Magovcevic I, Dryja TP: Characterization and chromosomal localization of the gene for human rhodopsin kinase. Genomics. 1996 Aug 1;35(3):571-6. [PubMed:8812493 ]
  4. Yamamoto S, Khani SC, Berson EL, Dryja TP: Evaluation of the rhodopsin kinase gene in patients with retinitis pigmentosa. Exp Eye Res. 1997 Aug;65(2):249-53. [PubMed:9268593 ]
  5. Yamamoto S, Sippel KC, Berson EL, Dryja TP: Defects in the rhodopsin kinase gene in the Oguchi form of stationary night blindness. Nat Genet. 1997 Feb;15(2):175-8. [PubMed:9020843 ]
  6. Hayashi T, Gekka T, Takeuchi T, Goto-Omoto S, Kitahara K: A novel homozygous GRK1 mutation (P391H) in 2 siblings with Oguchi disease with markedly reduced cone responses. Ophthalmology. 2007 Jan;114(1):134-41. Epub 2006 Oct 27. [PubMed:17070587 ]