You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01429
Secondary Accession Numbers
  • 6725
Name Ephrin type-A receptor 4
Synonyms
  1. EK8
  2. EPH-like kinase 8
  3. Tyrosine-protein kinase TYRO1
  4. Tyrosine-protein kinase receptor SEK
  5. hEK8
Gene Name EPHA4
Protein Type Enzyme
Biological Properties
General Function Involved in ephrin receptor activity
Specific Function Receptor for members of the ephrin-A family. Binds to ephrin-A1, -A4 and -A5. Binds more poorly to ephrin-A2 and -A3. May play a role in a signal transduction process involved in hindbrain pattern formation
Pathways Not Available
Reactions Not Available
GO Classification
Component
integral to plasma membrane
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
protein tyrosine kinase activity
transmembrane receptor protein tyrosine kinase activity
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
ephrin receptor activity
protein binding
protein kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
enzyme linked receptor protein signaling pathway
transmembrane receptor protein tyrosine kinase signaling pathway
metabolic process
cellular metabolic process
protein amino acid phosphorylation
signaling
signaling pathway
cell surface receptor linked signaling pathway
phosphorylation
Cellular Location
  1. Membrane
  2. Single-pass type I membrane protein
Gene Properties
Chromosome Location Chromosome:2
Locus 2q36.1
SNPs EPHA4
Gene Sequence
>2961 bp
ATGGCTGGGATTTTCTATTTCGCCCTATTTTCGTGTCTCTTCGGGATTTGCGACGCTGTC
ACAGGTTCCAGGGTATACCCCGCGAATGAAGTTACCTTATTGGATTCCAGATCTGTTCAG
GGAGAACTTGGGTGGATAGCAAGCCCTCTGGAAGGAGGGTGGGAGGAAGTGAGTATCATG
GATGAAAAAAATACACCAATCCGAACCTACCAAGTGTGCAATGTGATGGAACCCAGCCAG
AATAACTGGCTACGAACTGATTGGATCACCCGAGAAGGGGCTCAGAGGGTGTATATTGAG
ATTAAATTCACCTTGAGGGACTGCAATAGTCTTCCGGGCGTCATGGGGACTTGCAAGGAG
ACGTTTAACCTGTACTACTATGAATCAGACAACGACAAAGAGCGTTTCATCAGAGAGAAC
CAGTTTGTCAAAATTGACACCATTGCTGCTGATGAGAGCTTCACCCAAGTGGACATTGGT
GACAGAATCATGAAGCTGAACACCGAGATCCGGGATGTAGGGCCATTAAGCAAAAAGGGG
TTTTACCTGGCTTTTCAGGATGTGGGGGCCTGCATCGCCCTGGTATCAGTCCGTGTGTTC
TATAAAAAGTGTCCACTCACAGTCCGCAATCTGGCCCAGTTTCCTGACACCATCACAGGG
GCTGATACGTCTTCCCTGGTGGAAGTTCGAGGCTCCTGTGTCAACAACTCAGAAGAGAAA
GATGTGCCAAAAATGTACTGTGGGGCAGATGGTGAATGGCTGGTACCCATTGGCAACTGC
CTATGCAACGCTGGGCATGAGGAGCGGAGCGGAGAATGCCAAGCTTGCAAAATTGGATAT
TACAAGGCTCTCTCCACGGATGCCACCTGTGCCAAGTGCCCACCCCACAGCTACTCTGTC
TGGGAAGGAGCCACCTCGTGCACCTGTGACCGAGGCTTTTTCAGAGCTGACAACGATGCT
GCCTCTATGCCCTGCACCCGTCCACCATCTGCTCCCCTGAACTTGATTTCAAATGTCAAC
GAGACATCTGTGAACTTGGAATGGAGTAGCCCTCAGAATACAGGTGGCCGCCAGGACATT
TCCTATAATGTGGTATGCAAGAAATGTGGAGCTGGTGACCCCAGCAAGTGCCGACCCTGT
GGAAGTGGGGTCCACTACACCCCACAGCAGAATGGCTTGAAGACCACCAAAGTCTCCATC
ACTGACCTCCTAGCTCATACCAATTACACCTTTGAAATCTGGGCTGTGAATGGAGTGTCC
AAATATAACCCTAACCCAGACCAATCAGTTTCTGTCACTGTGACCACCAACCAAGCAGCA
CCATCATCCATTGCTTTGGTCCAGGCTAAAGAAGTCACAAGATACAGTGTGGCACTGGCT
TGGCTGGAACCAGATCGGCCCAATGGGGTAATCCTGGAATATGAAGTCAAGTATTATGAG
AAGGATCAGAATGAGCGAAGCTATCGTATAGTTCGGACAGCTGCCAGGAACACAGATATC
AAAGGCCTGAACCCTCTCACTTCCTATGTTTTCCACGTGCGAGCCAGGACAGCAGCTGGC
TATGGAGACTTCAGTGAGCCCTTGGAGGTTACAACCAACACAGTGCCTTCCCGGATCATT
GGAGATGGGGCTAACTCCACAGTCCTTCTGGTCTCTGTCTCGGGCAGTGTGGTGCTGGTG
GTAATTCTCATTGCAGCTTTTGTCATCAGCCGGAGACGGAGTAAATACAGTAAAGCCAAA
CAAGAAGCGGATGAAGAGAAACATTTGAATCAAGGTGTAAGAACATATGTGGACCCCTTT
ACGTACGAAGATCCCAACCAAGCAGTGCGAGAGTTTGCCAAAGAAATTGACGCATCCTGC
ATTAAGATTGAAAAAGTTATAGGAGTTGGTGAATTTGGTGAGGTATGCAGTGGGCGTCTC
AAAGTGCCTGGCAAGAGAGAGATCTGTGTGGCTATCAAGACTCTGAAAGCTGGTTATACA
GACAAACAGAGGAGAGACTTCCTGAGTGAGGCCAGCATCATGGGACAGTTTGACCATCCG
AACATCATTCACTTGGAAGGCGTGGTCACTAAATGTAAACCAGTAATGATCATAACAGAG
TACATGGAGAATGGCTCCTTGGATGCATTCCTCAGGAAAAATGATGGCAGATTTACAGTC
ATTCAGCTGGTGGGCATGCTTCGTGGCATTGGGTCTGGGATGAAGTATTTATCTGATATG
AGCTATGTGCATCGTGATCTGGCCGCACGGAACATCCTGGTGAACAGCAACTTGGTCTGC
AAAGTGTCTGATTTTGGCATGTCCCGAGTGCTTGAGGATGATCCGGAAGCAGCTTACACC
ACCAGGGGTGGCAAGATTCCTATCCGGTGGACTGCGCCAGAAGCAATTGCCTATCGTAAA
TTCACATCAGCAAGTGATGTATGGAGCTATGGAATCGTTATGTGGGAAGTGATGTCGTAC
GGGGAGAGGCCCTATTGGGATATGTCCAATCAAGATGTGATTAAAGCCATTGAGGAAGGC
TATCGGTTACCCCCTCCAATGGACTGCCCCATTGCGCTCCACCAGCTGATGCTAGACTGC
TGGCAGAAGGAGAGGAGCGACAGGCCTAAATTTGGGCAGATTGTCAACATGTTGGACAAA
CTCATCCGCAACCCCAACAGCTTGAAGAGGACAGGGACGGAGAGCTCCAGACCTAACACT
GCCTTGTTGGATCCAAGCTCCCCTGAATTCTCTGCTGTGGTATCAGTGGGCGATTGGCTC
CAGGCCATTAAAATGGACCGGTATAAGGATAACTTCACAGCTGCTGGTTATACCACACTA
GAGGCTGTGGTGCACGTGAACCAGGAGGACCTGGCAAGAATTGGTATCACAGCCATCACG
CACCAGAATAAGATTTTGAGCAGTGTCCAGGCAATGCGAACCCAAATGCAGCAGATGCAC
GGCAGAATGGTTCCCGTCTGA
Protein Properties
Number of Residues 986
Molecular Weight 109859.1
Theoretical pI 6.56
Pfam Domain Function
Signals
  • 1-19
Transmembrane Regions
  • 548-569
Protein Sequence
>Ephrin type-A receptor 4
MAGIFYFALFSCLFGICDAVTGSRVYPANEVTLLDSRSVQGELGWIASPLEGGWEEVSIM
DEKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKE
TFNLYYYESDNDKERFIRENQFVKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKG
FYLAFQDVGACIALVSVRVFYKKCPLTVRNLAQFPDTITGADTSSLVEVRGSCVNNSEEK
DVPKMYCGADGEWLVPIGNCLCNAGHEERSGECQACKIGYYKALSTDATCAKCPPHSYSV
WEGATSCTCDRGFFRADNDAASMPCTRPPSAPLNLISNVNETSVNLEWSSPQNTGGRQDI
SYNVVCKKCGAGDPSKCRPCGSGVHYTPQQNGLKTTKVSITDLLAHTNYTFEIWAVNGVS
KYNPNPDQSVSVTVTTNQAAPSSIALVQAKEVTRYSVALAWLEPDRPNGVILEYEVKYYE
KDQNERSYRIVRTAARNTDIKGLNPLTSYVFHVRARTAAGYGDFSEPLEVTTNTVPSRII
GDGANSTVLLVSVSGSVVLVVILIAAFVISRRRSKYSKAKQEADEEKHLNQGVRTYVDPF
TYEDPNQAVREFAKEIDASCIKIEKVIGVGEFGEVCSGRLKVPGKREICVAIKTLKAGYT
DKQRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFTV
IQLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRVLEDDPEAAYT
TRGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEG
YRLPPPMDCPIALHQLMLDCWQKERSDRPKFGQIVNMLDKLIRNPNSLKRTGTESSRPNT
ALLDPSSPEFSAVVSVGDWLQAIKMDRYKDNFTAAGYTTLEAVVHVNQEDLARIGITAIT
HQNKILSSVQAMRTQMQQMHGRMVPV
GenBank ID Protein 85397101
UniProtKB/Swiss-Prot ID P54764
UniProtKB/Swiss-Prot Entry Name EPHA4_HUMAN
PDB IDs Not Available
GenBank Gene ID BC105000
GeneCard ID EPHA4
GenAtlas ID EPHA4
HGNC ID HGNC:3388
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  3. Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ: Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer. Cell. 2007 Dec 14;131(6):1190-203. [PubMed:18083107 ]
  4. Heibeck TH, Ding SJ, Opresko LK, Zhao R, Schepmoes AA, Yang F, Tolmachev AV, Monroe ME, Camp DG 2nd, Smith RD, Wiley HS, Qian WJ: An extensive survey of tyrosine phosphorylation revealing new sites in human mammary epithelial cells. J Proteome Res. 2009 Aug;8(8):3852-61. doi: 10.1021/pr900044c. [PubMed:19534553 ]
  5. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  6. Fox GM, Holst PL, Chute HT, Lindberg RA, Janssen AM, Basu R, Welcher AA: cDNA cloning and tissue distribution of five human EPH-like receptor protein-tyrosine kinases. Oncogene. 1995 Mar 2;10(5):897-905. [PubMed:7898931 ]