You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01432
Secondary Accession Numbers
  • 6728
Name Serine/threonine-protein kinase Nek7
Synonyms
  1. Never in mitosis A-related kinase 7
  2. NimA-related protein kinase 7
Gene Name NEK7
Protein Type Unknown
Biological Properties
General Function Involved in protein kinase activity
Specific Function ATP + a protein = ADP + a phosphoprotein
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein kinase activity
protein serine/threonine kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location Chromosome:1
Locus 1q31.3
SNPs NEK7
Gene Sequence
>909 bp
ATGGATGAGCAATCACAAGGAATGCAAGGGCCACCTGTTCCTCAGTTCCAACCACAGAAG
GCCTTACGACCGGATATGGGCTATAATACATTAGCCAACTTTCGAATAGAAAAGAAAATT
GGTCGCGGACAATTTAGTGAAGTTTATAGAGCAGCCTGTCTCTTGGATGGAGTACCAGTA
GCTTTAAAAAAAGTGCAGATATTTGATTTAATGGATGCCAAAGCACGTGCTGATTGCATC
AAAGAAATAGATCTTCTTAAGCAACTCAACCATCCAAATGTAATAAAATATTATGCATCA
TTCATTGAAGATAATGAACTAAACATAGTTTTGGAACTAGCAGATGCTGGCGACCTATCC
AGAATGATCAAGCATTTTAAGAAGCAAAAGAGGCTAATTCCTGAAAGAACTGTTTGGAAG
TATTTTGTTCAGCTTTGCAGTGCATTGGAACACATGCATTCTCGAAGAGTCATGCATAGA
GATATAAAACCAGCTAATGTGTTCATTACAGCCACTGGGGTGGTAAAACTTGGAGATCTT
GGGCTTGGCCGGTTTTTCAGCTCAAAAACCACAGCTGCACATTCTTTAGTTGGTACGCCT
TATTACATGTCTCCAGAGAGAATACATGAAAATGGATACAACTTCAAATCTGACATCTGG
TCTCTTGGCTGTCTACTATATGAGATGGCTGCATTACAAAGTCCTTTCTATGGTGACAAA
ATGAATTTATACTCACTGTGTAAGAAGATAGAACAGTGTGACTACCCACCTCTTCCTTCA
GATCACTATTCAGAAGAACTCCGACAGTTAGTTAATATGTGCATCAACCCAGATCCAGAG
AAGCGACCAGACGTCACCTATGTTTATGACGTAGCAAAGAGGATGCATGCATGCACTGCA
AGCAGCTAA
Protein Properties
Number of Residues 302
Molecular Weight 34550.7
Theoretical pI 8.37
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Serine/threonine-protein kinase Nek7
MDEQSQGMQGPPVPQFQPQKALRPDMGYNTLANFRIEKKIGRGQFSEVYRAACLLDGVPV
ALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLS
RMIKHFKKQKRLIPERTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDL
GLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDK
MNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNMCINPDPEKRPDVTYVYDVAKRMHACTA
SS
GenBank ID Protein 19032281
UniProtKB/Swiss-Prot ID Q8TDX7
UniProtKB/Swiss-Prot Entry Name NEK7_HUMAN
PDB IDs Not Available
GenBank Gene ID AB062450
GeneCard ID NEK7
GenAtlas ID NEK7
HGNC ID HGNC:13386
References
General References
  1. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  2. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  3. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  4. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  5. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  6. Kimura M, Okano Y: Identification and assignment of the human NIMA-related protein kinase 7 gene (NEK7) to human chromosome 1q31.3. Cytogenet Cell Genet. 2001;94(1-2):33-8. [PubMed:11701951 ]