You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01438
Secondary Accession Numbers
  • 6734
Name Tyrosine-protein kinase Blk
Synonyms
  1. B lymphocyte kinase
  2. p55-Blk
Gene Name BLK
Protein Type Enzyme
Biological Properties
General Function Involved in protein kinase activity
Specific Function May function in a signal transduction pathway that is restricted to B-lymphoid cells
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein binding
protein kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:8
Locus 8p23-p22
SNPs BLK
Gene Sequence
>1518 bp
ATGGGGCTGGTAAGTAGCAAAAAGCCGGACAAGGAAAAGCCGATCAAAGAGAAGGACAAG
GGCCAATGGAGCCCCCTGAAGGTCAGCGCCCAAGACAAGGACGCCCCGCCACTGCCGCCC
CTGGTTGTCTTCAACCACCTTACTCCTCCACCGCCCGATGAACACCTGGATGAAGACAAG
CATTTCGTGGTGGCTCTGTATGACTACACCGCTATGAATGATCGGGACCTGCAGATGCTG
AAGGGGGAGAAGCTACAGGTCCTGAAGGGAACTGGAGACTGGTGGCTGGCCAGGTCACTC
GTCACAGGAAGAGAAGGCTATGTGCCCAGTAACTTTGTGGCCCGAGTGGAGAGCCTGGAA
ATGGAAAGGTGGTTCTTTAGATCACAGGGTCGGAAGGAGGCTGAGAGGCAGCTTCTTGCT
CCAATCAACAAGGCCGGCTCCTTTCTTATCAGAGAGAGTGAAACCAACAAAGGTGCCTTC
TCCCTGTCTGTGAAGGATGTCACCACCCAGGGGGAGCTGATCAAGCACTATAAGATCCGC
TGCCTGGATGAAGGGGGCTACTACATCTCCCCCCGGATCACCTTCCCCTCGCTCCAGGCC
CTGGTGCAGCACTATTCTAAGAAGGGGGATGGTCTATGCCAGAGGCTGACCCTGCCCTGT
GTGCGCCCGGCCCCGCAGAATCCCTGGGCCCAGGATGAATGGGAGATCCCCCGGCAGTCT
CTCAGGCTGGTCAGGAAACTCGGGTCTGGACAATTCGGCGAAGTCTGGATGGGTTACTAC
AAAAACAACATGAAGGTGGCCATTAAGACGCTGAAGGAGGGAACCATGTCTCCAGAAGCC
TTCCTGGGTGAGGCCAACGTGATGAAGGCTCTGCAGCACGAGCGGCTGGTCCGACTCTAC
GCAGTGGTCACCAAGGAGCCCATCTACATTGTCACCGAGTACATGGCCAGAGGATGCCTG
CTGGATTTCCTGAAGACAGATGAAGGGAGCAGATTGTCACTCCCAAGGCTGATTGACATG
TCGGCGCAGATTGCTGAAGGGATGGCATACATTGAGCGCATGAATTCCATCCACCGCGAC
CTGCGGGCGGCCAACATCCTGGTGTCTGAGGCCTTGTGCTGCAAAATTGCTGATTTTGGC
TTGGCTCGAATCATCGACAGTGAATACACGGCCCAAGAGGGGGCCAAGTTCCCCATCAAG
TGGACAGCCCCGGAAGCCTACCACTTCGGGGTCTTCACCATCAAAGCAGACGTGTGGTCG
TTTGGAGTCCTCCTGATGGAAGTTGTCACTTATGGGCGGGTGCCATACCCAGGGATGAGC
AACCCCGAGGTCATCCGCAACCTGGAGCGCGGCTACCGCATGCCGCGCCCCGACACCTGC
CCGCCCGAGCTGTACCGCGGCGTCATCGCCGAGTGCTGGCGCAGCCGGCCCGAGGAGCGG
CCCACCTTCGAGTTCCTGCAGTCGGTGCTGGAGGACTTCTACACGGCCACCGAGCGGCAG
TACGAGCTGCAGCCCTAG
Protein Properties
Number of Residues 505
Molecular Weight 57706.0
Theoretical pI 7.98
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Tyrosine-protein kinase Blk
MGLVSSKKPDKEKPIKEKDKGQWSPLKVSAQDKDAPPLPPLVVFNHLTPPPPDEHLDEDK
HFVVALYDYTAMNDRDLQMLKGEKLQVLKGTGDWWLARSLVTGREGYVPSNFVARVESLE
MERWFFRSQGRKEAERQLLAPINKAGSFLIRESETNKGAFSLSVKDVTTQGELIKHYKIR
CLDEGGYYISPRITFPSLQALVQHYSKKGDGLCQRLTLPCVRPAPQNPWAQDEWEIPRQS
LRLVRKLGSGQFGEVWMGYYKNNMKVAIKTLKEGTMSPEAFLGEANVMKALQHERLVRLY
AVVTKEPIYIVTEYMARGCLLDFLKTDEGSRLSLPRLIDMSAQIAEGMAYIERMNSIHRD
LRAANILVSEALCCKIADFGLARIIDSEYTAQEGAKFPIKWTAPEAIHFGVFTIKADVWS
FGVLLMEVVTYGRVPYPGMSNPEVIRNLERGYRMPRPDTCPPELYRGVIAECWRSRPEER
PTFEFLQSVLEDFYTATERQYELQP
GenBank ID Protein 914204
UniProtKB/Swiss-Prot ID P51451
UniProtKB/Swiss-Prot Entry Name BLK_HUMAN
PDB IDs Not Available
GenBank Gene ID S76617
GeneCard ID BLK
GenAtlas ID BLK
HGNC ID HGNC:1057
References
General References
  1. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  2. Islam KB, Rabbani H, Larsson C, Sanders R, Smith CI: Molecular cloning, characterization, and chromosomal localization of a human lymphoid tyrosine kinase related to murine Blk. J Immunol. 1995 Feb 1;154(3):1265-72. [PubMed:7822795 ]
  3. Drebin JA, Hartzell SW, Griffin C, Campbell MJ, Niederhuber JE: Molecular cloning and chromosomal localization of the human homologue of a B-lymphocyte specific protein tyrosine kinase (blk). Oncogene. 1995 Feb 2;10(3):477-86. [PubMed:7845672 ]