You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01444
Secondary Accession Numbers
  • 6740
Name Potassium-transporting ATPase subunit beta
Synonyms
  1. Gastric H(+)/K(+) ATPase subunit beta
  2. Proton pump beta chain
Gene Name ATP4B
Protein Type Enzyme
Biological Properties
General Function Involved in sodium:potassium-exchanging ATPase activity
Specific Function Not Available
Pathways
  • Betazole Action Pathway
  • Cimetidine Action Pathway
  • Esomeprazole Action Pathway
  • Esomeprazole Metabolism Pathway
  • Famotidine Action Pathway
  • Gastric Acid Production
  • Lafutidine H2-Antihistamine Action
  • Lansoprazole Action Pathway
  • Lansoprazole Metabolism Pathway
  • Metiamide Action Pathway
  • Nizatidine Action Pathway
  • Omeprazole Action Pathway
  • Omeprazole Metabolism Pathway
  • Pantoprazole Action Pathway
  • Pantoprazole Metabolism Pathway
  • Pirenzepine Action Pathway
  • Rabeprazole Action Pathway
  • Rabeprazole Metabolism Pathway
  • Ranitidine Action Pathway
  • Roxatidine acetate Action Pathway
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
potassium ion transmembrane transporter activity
potassium-transporting atpase activity
sodium:potassium-exchanging atpase activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
cation transmembrane transporter activity
inorganic cation transmembrane transporter activity
monovalent inorganic cation transmembrane transporter activity
transporter activity
Process
purine nucleotide metabolic process
purine nucleotide biosynthetic process
purine nucleoside triphosphate biosynthetic process
purine ribonucleoside triphosphate biosynthetic process
metabolic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
sodium ion transport
establishment of localization
transport
monovalent inorganic cation transport
potassium ion transport
ion transport
atp biosynthetic process
cation transport
Cellular Location
  1. Membrane
  2. Single-pass type II membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 13q34
SNPs ATP4B
Gene Sequence
>876 bp
ATGGCGGCTCTGCAGGAGAAGAAGACGTGTGGCCAGCGCATGGAGGAGTTCCAGCGTTAC
TGCTGGAACCCGGACACGGGGCAGATGCTGGGCCGCACCCTGTCCCGGTGGGTGTGGATC
AGCCTGTACTACGTGGCCTTCTACGTGGTGATGACTGGGCTCTTCGCCCTGTGCCTCTAT
GTGCTGATGCAGACAGTGGACCCGTACACACCGGACTACCAAGACCAGCTACGGTCACCA
GGGGTAACCTTAAGGCCGGATGTTTACGGGGAGAAAGGCCTGGAAATTGTCTACAACGTC
TCTGATAACAGAACCTGGGCAGACCTCACACAGACTCTCCACGCCTTCCTAGCAGGCTAC
TCTCCAGCAGCCCAGGAGGACAGCATCAACTGCACCTCCGAGCAGTACTTCTTCCAGGAG
AGTTTCCGCGCTCCCAACCACACCAAGTTCTCCTGCAAGTTCACGGCAGATATGCTGCAG
AACTGCTCAGGCCTGGCGGATCCCAACTTCGGCTTTGAAGAAGGAAAGCCATGTTTTATT
ATTAAAATGAACAGGATCGTCAAGTTCCTCCCCAGCAACGGCTCGGCCCCCAGAGTGGAC
TGCGCCTTCCTGGACCAGCCCCGCGAGCTCGGCCAGCCGCTGCAGGTCAAGTACTACCCT
CCCAACGGCACCTTCAGTCTGCACTACTTCCCTTATTACGGGAAGAAAGCCCAGCCCCAC
TACAGCAACCCCCTGGTGGCAGCGAAGCTCCTCAACATCCCCAGGAACGCTGAGGTCGCC
ATCGTGTGCAAGGTCATGGCGGAGCACGTGACCTTCAACAATCCCCACGACCCGTATGAA
GGGAAAGTGGAGTTCAAACTCAAGATTGAGAAGTGA
Protein Properties
Number of Residues 291
Molecular Weight 33367.0
Theoretical pI 7.37
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 37-57
Protein Sequence
>Potassium-transporting ATPase subunit beta
MAALQEKKTCGQRMEEFQRYCWNPDTGQMLGRTLSRWVWISLYYVAFYVVMTGLFALCLY
VLMQTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGY
SPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGKPCFI
IKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPH
YSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK
GenBank ID Protein 4557339
UniProtKB/Swiss-Prot ID P51164
UniProtKB/Swiss-Prot Entry Name ATP4B_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_000705.3
GeneCard ID ATP4B
GenAtlas ID ATP4B
HGNC ID HGNC:820
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dunham A, Matthews LH, Burton J, Ashurst JL, Howe KL, Ashcroft KJ, Beare DM, Burford DC, Hunt SE, Griffiths-Jones S, Jones MC, Keenan SJ, Oliver K, Scott CE, Ainscough R, Almeida JP, Ambrose KD, Andrews DT, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Bannerjee R, Barlow KF, Bates K, Beasley H, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burrill W, Carder C, Carter NP, Chapman JC, Clamp ME, Clark SY, Clarke G, Clee CM, Clegg SC, Cobley V, Collins JE, Corby N, Coville GJ, Deloukas P, Dhami P, Dunham I, Dunn M, Earthrowl ME, Ellington AG, Faulkner L, Frankish AG, Frankland J, French L, Garner P, Garnett J, Gilbert JG, Gilson CJ, Ghori J, Grafham DV, Gribble SM, Griffiths C, Hall RE, Hammond S, Harley JL, Hart EA, Heath PD, Howden PJ, Huckle EJ, Hunt PJ, Hunt AR, Johnson C, Johnson D, Kay M, Kimberley AM, King A, Laird GK, Langford CJ, Lawlor S, Leongamornlert DA, Lloyd DM, Lloyd C, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, McLaren SJ, McMurray A, Milne S, Moore MJ, Nickerson T, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter KM, Rice CM, Searle S, Sehra HK, Shownkeen R, Skuce CD, Smith M, Steward CA, Sycamore N, Tester J, Thomas DW, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Wilming L, Wray PW, Wright MW, Young L, Coulson A, Durbin R, Hubbard T, Sulston JE, Beck S, Bentley DR, Rogers J, Ross MT: The DNA sequence and analysis of human chromosome 13. Nature. 2004 Apr 1;428(6982):522-8. [PubMed:15057823 ]
  3. Ma JY, Song YH, Sjostrand SE, Rask L, Mardh S: cDNA cloning of the beta-subunit of the human gastric H,K-ATPase. Biochem Biophys Res Commun. 1991 Oct 15;180(1):39-45. [PubMed:1656976 ]
  4. Yoshida T, Sato R, Mahmood S, Kawasaki S, Futai M, Maeda M: GATA-6 DNA binding protein expressed in human gastric adenocarcinoma MKN45 cells. FEBS Lett. 1997 Sep 8;414(2):333-7. [PubMed:9315713 ]