Hmdb loader
Survey

Showing Protein V-type proton ATPase 16 kDa proteolipid subunit (HMDBP01481)

IdentificationBiological propertiesGene propertiesProtein propertiesExternal linksReferencesXMLShow 4 metabolites
Identification
HMDB Protein ID HMDBP01481
Secondary Accession Numbers
  • 6777
Name V-type proton ATPase 16 kDa proteolipid subunit
Synonyms
  1. V-ATPase 16 kDa proteolipid subunit
  2. Vacuolar proton pump 16 kDa proteolipid subunit
Gene Name ATP6V0C
Protein Type Enzyme
Biological Properties
General Function Involved in hydrogen ion transmembrane transporter activity
Specific Function Proton-conducting pore forming subunit of the membrane integral V0 complex of vacuolar ATPase. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells
Pathways Not Available
Reactions Not Available
GO Classification
Component
macromolecular complex
protein complex
proton-transporting two-sector atpase complex, proton-transporting domain
proton-transporting v-type atpase, v0 domain
proton-transporting atp synthase complex, coupling factor f(o)
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
cation transmembrane transporter activity
inorganic cation transmembrane transporter activity
monovalent inorganic cation transmembrane transporter activity
hydrogen ion transmembrane transporter activity
transporter activity
Process
purine nucleotide metabolic process
purine nucleotide biosynthetic process
purine nucleoside triphosphate biosynthetic process
purine ribonucleoside triphosphate biosynthetic process
metabolic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
atp synthesis coupled proton transport
atp biosynthetic process
Cellular Location
  1. Multi-pass membrane protein
  2. Vacuole membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 16p13.3
SNPs ATP6V0C
Gene Sequence 
>468 bp
ATGTCCGAGTCCAAGAGCGGCCCCGAGTATGCTTCGTTTTTCGCCGTCATGGGCGCCTCG
GCCGCCATGGTCTTCAGCGCCCTGGGCGCTGCCTATGGCACAGCCAAGAGCGGTACCGGC
ATTGCGGCCATGTCTGTCATGCGGCCGGAGCAGATCATGAAGTCCATCATCCCAGTGGTC
ATGGCTGGCATCATCGCCATCTACGGCCTGGTGGTGGCAGTCCTCATCGCCAACTCCCTG
AATGACGACATCAGCCTCTACAAGAGCTTCCTCCAGCTGGGCGCCGGCCTGAGCGTGGGC
CTGAGCGGCCTGGCAGCCGGCTTTGCCATCGGCATCGTGGGGGACGCTGGCGTGCGGGGC
ACCGCCCAGCAGCCCCGACTATTCGTGGGCATGATCCTGATTCTCATCTTCGCCGAGGTG
CTCGGCCTCTACGGTCTCATCGTCGCCCTCATCCTCTCCACAAAGTAG
Protein Properties
Number of Residues 155
Molecular Weight 15735.6
Theoretical pI 8.88
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 11-33
  • 56-76
  • 93-114
  • 132-152
Protein Sequence 
>V-type proton ATPase 16 kDa proteolipid subunit
MSESKSGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEQIMKSIIPVV
MAGIIAIYGLVVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRG
TAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK
GenBank ID Protein 13528675
UniProtKB/Swiss-Prot ID P27449
UniProtKB/Swiss-Prot Entry Name VATL_HUMAN
PDB IDs Not Available
GenBank Gene ID BC004537
GeneCard ID ATP6V0C
GenAtlas ID ATP6V0C
HGNC ID HGNC:855
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gillespie GA, Somlo S, Germino GG, Weinstat-Saslow D, Reeders ST: CpG island in the region of an autosomal dominant polycystic kidney disease locus defines the 5' end of a gene encoding a putative proton channel. Proc Natl Acad Sci U S A. 1991 May 15;88(10):4289-93. [PubMed:1709739 ]
  3. Hasebe M, Hanada H, Moriyama Y, Maeda M, Futai M: Vacuolar type H(+)-ATPase genes: presence of four genes including pseudogenes for the 16-kDa proteolipid subunit in the human genome. Biochem Biophys Res Commun. 1992 Mar 16;183(2):856-63. [PubMed:1532310 ]
  4. Koralnik IJ, Mulloy JC, Andresson T, Fullen J, Franchini G: Mapping of the intermolecular association of human T cell leukaemia/lymphotropic virus type I p12I and the vacuolar H+-ATPase 16 kDa subunit protein. J Gen Virol. 1995 Aug;76 ( Pt 8):1909-16. [PubMed:7636472 ]
  5. Pan H, Qin WX, Huo KK, Wan DF, Yu Y, Xu ZG, Hu QD, Gu KT, Zhou XM, Jiang HQ, Zhang PP, Huang Y, Li YY, Gu JR: Cloning, mapping, and characterization of a human homologue of the yeast longevity assurance gene LAG1. Genomics. 2001 Sep;77(1-2):58-64. [PubMed:11543633 ]
  6. Liu QY, Lei JX, Sikorska M, Liu R: A novel brain-enriched E3 ubiquitin ligase RNF182 is up regulated in the brains of Alzheimer's patients and targets ATP6V0C for degradation. Mol Neurodegener. 2008 Feb 25;3:4. doi: 10.1186/1750-1326-3-4. [PubMed:18298843 ]