Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01483
Secondary Accession Numbers
  • 6779
Name Mitogen-activated protein kinase 4
Synonyms
  1. ERK-4
  2. Extracellular signal-regulated kinase 4
  3. MAP kinase 4
  4. MAP kinase isoform p63
  5. MAPK 4
  6. p63-MAPK
Gene Name MAPK4
Protein Type Unknown
Biological Properties
General Function Involved in MAP kinase activity
Specific Function Phosphorylates microtubule-associated protein 2 (MAP2). May promote entry in the cell cycle
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein kinase activity
protein serine/threonine kinase activity
receptor signaling protein serine/threonine kinase activity
map kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 18q21.2
SNPs MAPK4
Gene Sequence
>1764 bp
ATGGCTGAGAAGGGTGACTGCATCGCCAGTGTCTATGGGTATGACCTCGGTGGGCGCTTT
GTTGACTTCCAACCCCTGGGCTTCGGTGTCAATGGTTTGGTGCTGTCGGCCGTGGACAGC
CGGGCCTGCCGGAAGGTCGCTGTGAAGAAGATTGCCCTGAGCGATGCCCGCAGCATGAAG
CACGCGCTCCGAGAGATCAAGATCATTCGGCGCCTGGACCACGACAACATCGTCAAAGTG
TACGAGGTGCTCGGTCCCAAGGGCACTGACCTGCAGGGTGAGCTGTTCAAGTTCAGCGTG
GCGTACATCGTCCAGGAGTACATGGAGACCGACCTGGCACGCCTGCTGGAGCAGGGCACG
CTGGCAGAAGAGCATGCCAAGCTGTTCATGTACCAGCTGCTCCGCGGGCTCAAGTACATC
CACTCCGCCAACGTGCTGCACAGGGACCTGAAGCCCGCCAACATCTTCATCAGCACAGAG
GACCTCGTGCTCAAGATTGGGGATTTCGGGTTGGCAAGGATCGTTGATCAGCATTACTCC
CACAAGGGTTATCTGTCAGAAGGGTTGGTAACAAAGTGGTACCGTTCCCCACGACTGCTC
CTTTCCCCCAATAACTACACCAAAGCCATCGACATGTGGGCCGCCGGCTGCATCCTGGCT
GAGATGCTTACGGGGAGAATGCTCTTTGCTGGGGCCCATGAGCTGGAGCAGATGCAACTC
ATCCTGGAGACCATCCCTGTAATCCGGGAGGAAGACAAGGACGAGCTGCTCAGGGTGATG
CCTTCCTTTGTCAGCAGCACCTGGGAGGTGAAGAGGCCTCTGCGCAAGCTGCTCCCTGAA
GTGAACAGTGAAGCCATCGACTTTCTGGAGAAGATCCTGACCTTTAACCCCATGGATCGC
CTAACAGCTGAGATGGGGCTGCAACACCCCTACATGAGCCCATACTCGTGCCCTGAGGAC
GAGCCCACCTCACAACACCCCTTCCGCATTGAGGATGAGATCGACGACATCGTGCTGATG
GCCGCTAACCAGAGCCAGCTGTCCAACTGGGACACGTGCAGTTCCAGGTACCCTGTGAGC
CTGTCGTCGGACCTGGAGTGGCGGCCTGACCGGTGCCAGGACGCCAGCGAGGTACAGCGC
GACCCGCGCGCGGGTTCGGCGCCACTGGCTGAGGACGTGCAGGTGGACCCGCGCAAGGAC
TCGCACAGCAGCTCCGAGCGCTTCCTAGAGCAGTCGCACTCGTCCATGGAGCGCGCCTTC
GAGGCCGACTACGGGCGCTCCTGCGACTACAAGGTGGGGTCGCCGTCCTACCTGGACAAG
CTGCTGTGGCGCGACAACAAGCCGCACCACTACTCGGAGCCCAAGCTCATCCTGGACCTG
TCGCACTGGAAGCAGGCGGCCGGCGCGCCCCCCACGGCCACGGGGCTGGCGGACACGGGG
GCGCGCGAGGACGAGCCGGCCAGCCTCTTCCTGGAGATCGCGCAGTGGGTCAAGAGCACG
CAGGGCGGCCCAGAGCACGCCAGCCCGCCCGCCGACGACCCCGAGCGCCGCTTGTCTGCC
TCGCCCCCCGGCCGCCCGGCCCCGGTGGACGGCGGCGCCAGCCCCCAGTTCGACCTGGAC
GTGTTCATCTCCCGCGCCCTGAAGCTCTGCACCAAGCCCGAGGACCTGCCGGACAATAAA
CTGGGCGACCTCAATGGTGCGTGCATCCCCGAGCACCCTGGCGACCTCGTGCAGACCGAG
GCCTTCTCCAAAGAAAGGTGGTGA
Protein Properties
Number of Residues 587
Molecular Weight 65921.0
Theoretical pI 5.11
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Mitogen-activated protein kinase 4
MAEKGDCIASVYGYDLGGRFVDFQPLGFGVNGLVLSAVDSRACRKVAVKKIALSDARSMK
HALREIKIIRRLDHDNIVKVYEVLGPKGTDLQGELFKFSVAYIVQEYMETDLARLLEQGT
LAEEHAKLFMYQLLRGLKYIHSANVLHRDLKPANIFISTEDLVLKIGDFGLARIVDQHYS
HKGYLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCILAEMLTGRMLFAGAHELEQMQL
ILETIPVIREEDKDELLRVMPSFVSSTWEVKRPLRKLLPEVNSEAIDFLEKILTFNPMDR
LTAEMGLQHPYMSPYSCPEDEPTSQHPFRIEDEIDDIVLMAANQSQLSNWDTCSSRYPVS
LSSDLEWRPDRCQDASEVQRDPRAGSAPLAEDVQVDPRKDSHSSSERFLEQSHSSMERAF
EADYGRSCDYKVGSPSYLDKLLWRDNKPHHYSEPKLILDLSHWKQAAGAPPTATGLADTG
AREDEPASLFLEIAQWVKSTQGGPEHASPPADDPERRLSASPPGRPAPVDGGASPQFDLD
VFISRALKLCTKPEDLPDNKLGDLNGACIPEHPGDLVQTEAFSKERW
GenBank ID Protein 89276769
UniProtKB/Swiss-Prot ID P31152
UniProtKB/Swiss-Prot Entry Name MK04_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_002747.3
GeneCard ID MAPK4
GenAtlas ID MAPK4
HGNC ID HGNC:6878
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  4. Gonzalez FA, Raden DL, Rigby MR, Davis RJ: Heterogeneous expression of four MAP kinase isoforms in human tissues. FEBS Lett. 1992 Jun 15;304(2-3):170-8. [PubMed:1319925 ]
  5. Nusbaum C, Zody MC, Borowsky ML, Kamal M, Kodira CD, Taylor TD, Whittaker CA, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Yang X, Abouelleil A, Allen NR, Anderson S, Bloom T, Bugalter B, Butler J, Cook A, DeCaprio D, Engels R, Garber M, Gnirke A, Hafez N, Hall JL, Norman CH, Itoh T, Jaffe DB, Kuroki Y, Lehoczky J, Lui A, Macdonald P, Mauceli E, Mikkelsen TS, Naylor JW, Nicol R, Nguyen C, Noguchi H, O'Leary SB, O'Neill K, Piqani B, Smith CL, Talamas JA, Topham K, Totoki Y, Toyoda A, Wain HM, Young SK, Zeng Q, Zimmer AR, Fujiyama A, Hattori M, Birren BW, Sakaki Y, Lander ES: DNA sequence and analysis of human chromosome 18. Nature. 2005 Sep 22;437(7058):551-5. [PubMed:16177791 ]