You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01484
Secondary Accession Numbers
  • 6780
Name Cell division protein kinase 19
Synonyms
  1. CDC2-related protein kinase 6
  2. Cell division cycle 2-like protein kinase 6
  3. Cyclin-dependent kinase 11
  4. Death-preventing kinase
Gene Name CDK19
Protein Type Enzyme
Biological Properties
General Function Involved in protein kinase activity
Specific Function ATP + a protein = ADP + a phosphoprotein
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein kinase activity
protein serine/threonine kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:6
Locus 6q21
SNPs CDK19
Gene Sequence
>1509 bp
ATGGATTATGATTTCAAGGCGAAGCTGGCGGCGGAGCGGGAGCGGGTGGAGGATTTGTTT
GAGTACGAAGGGTGCAAAGTGGGACGCGGCACCTACGGTCACGTCTACAAGGCGAGGCGG
AAAGATGGAAAAGATGAAAAGGAATATGCATTGAAGCAAATTGAAGGCACAGGAATATCC
ATGTCGGCTTGTAGAGAGATTGCACTTTTGCGAGAATTGAAGCACCCTAATGTGATTGCA
TTGCAGAAGGTGTTCCTTTCTCACAGTGACAGGAAGGTATGGCTGCTGTTTGATTATGCA
GAGCATGACTTGTGGCATATTATTAAGTTTCACCGTGCATCAAAAGCAAATAAAAAGCCC
ATGCAGTTGCCAAGATCTATGGTTAAATCCTTACTTTACCAGATTCTTGATGGTATCCAT
TACCTCCATGCAAATTGGGTGCTTCACAGAGACTTGAAACCAGCAAATATCCTAGTAATG
GGAGAAGGTCCTGAGAGGGGGAGAGTCAAAATAGCTGACATGGGTTTTGCCAGATTATTC
AATTCTCCTCTAAAGCCACTAGCAGATTTGGATCCAGTAGTTGTGACATTTTGGTATCGG
GCTCCAGAACTTTTGCTTGGTGCAAGGCATTATACAAAGGCCATTGATATATGGGCAATA
GGTTGTATATTTGCTGAATTGTTGACTTCGGAACCTATTTTTCACTGTCGTCAGGAAGAT
ATAAAAACAAGCAATCCCTTTCATCATGATCAACTGGATCGGATATTTAGTGTCATGGGG
TTTCCTGCAGATAAAGACTGGGAAGATATTAGAAAGATGCCAGAATATCCCACACTTCAA
AAAGACTTTAGAAGAACAACGTATGCCAACAGTAGCCTCATAAAGTACATGGAGAAACAC
AAGGTCAAGCCTGACAGCAAAGTGTTCCTCTTGCTTCAGAAACTCCTGACCATGGATCCA
ACCAAGAGAATTACCTCGGAGCAAGCTCTGCAGGATCCCTATTTTCAGGAGGACCCTTTG
CCAACATTAGATGTATTTGCCGGCTGCCAGATTCCATACCCCAAACGAGAATTCCTTAAT
GAAGATGATCCTGAAGAAAAAGGTGACAAGAATCAGCAACAGCAGCAGAACCAGCATCAG
CAGCCCACAGCCCCTCCACAGCAGGCAGCAGCCCCTCCACAGGCGCCCCCACCACAGCAG
AACAGCACCCAGACCAACGGGACCGCAGGTGGGGCTGGGGCCGGGGTCGGGGGCACCGGA
GCAGGGTTGCAGCACAGCCAGGACTCCAGCCTGAACCAGGTGCCTCCAAACAAGAAGCCA
CGGCTAGGGCCTTCAGGCGCAAACTCAGGTGGACCTGTGATGCCCTCGGATTATCAGCAC
TCCAGTTCTCGCCTGAATTACCAAAGCAGCGTTCAGGGATCCTCTCAGTCCCAGAGCACA
CTTGGCTACTCTTCCTCGTCTCAGCAGAGCTCACAGTACCACCCATCTCACCAGGCCCAC
CGGTACTGA
Protein Properties
Number of Residues 502
Molecular Weight 56801.8
Theoretical pI 8.77
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Cell division protein kinase 19
MDYDFKAKLAAERERVEDLFEYEGCKVGRGTYGHVYKARRKDGKDEKEYALKQIEGTGIS
MSACREIALLRELKHPNVIALQKVFLSHSDRKVWLLFDYAEHDLWHIIKFHRASKANKKP
MQLPRSMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLF
NSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQED
IKTSNPFHHDQLDRIFSVMGFPADKDWEDIRKMPEYPTLQKDFRRTTYANSSLIKYMEKH
KVKPDSKVFLLLQKLLTMDPTKRITSEQALQDPYFQEDPLPTLDVFAGCQIPYPKREFLN
EDDPEEKGDKNQQQQQNQHQQPTAPPQQAAAPPQAPPPQQNSTQTNGTAGGAGAGVGGTG
AGLQHSQDSSLNQVPPNKKPRLGPSGANSGGPVMPSDYQHSSSRLNYQSSVQGSSQSQST
LGYSSSSQQSSQYHPSHQAHRY
GenBank ID Protein 30387611
UniProtKB/Swiss-Prot ID Q9BWU1
UniProtKB/Swiss-Prot Entry Name CDK19_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_015076.3
GeneCard ID CDK19
GenAtlas ID CDK19
HGNC ID HGNC:19338
References
General References
  1. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  4. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  5. Nakajima D, Okazaki N, Yamakawa H, Kikuno R, Ohara O, Nagase T: Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones. DNA Res. 2002 Jun 30;9(3):99-106. [PubMed:12168954 ]
  6. Kikuno R, Nagase T, Ishikawa K, Hirosawa M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1999 Jun 30;6(3):197-205. [PubMed:10470851 ]