Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01494
Secondary Accession Numbers
  • 6790
Name Tyrosine-protein kinase Fes/Fps
Synonyms
  1. Proto-oncogene c-Fes
  2. Proto-oncogene c-Fps
Gene Name FES
Protein Type Enzyme
Biological Properties
General Function Involved in protein kinase activity
Specific Function ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate
Pathways Not Available
Reactions Not Available
GO Classification
Function
protein tyrosine kinase activity
non-membrane spanning protein tyrosine kinase activity
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein binding
protein kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
peptidyl-tyrosine phosphorylation
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 15q26.1
SNPs FES
Gene Sequence
>2469 bp
ATGGGCTTCTCTTCCGAGCTGTGCAGCCCCCAGGGCCACGGGGTCCTGCAGCAAATGCAG
GAGGCCGAGCTTCGTCTACTGGAGGGCATGAGAAAGTGGATGGCCCAGCGGGTCAAGAGT
GACAGGGAGTATGCAGGACTGCTTCACCACATGTCCCTGCAGGACAGTGGGGGCCAGAGC
CGGGCCATCAGCCCTGACAGCCCCATCAGTCAGTCCTGGGCTGAGATCACCAGCCAAACT
GAGGGCCTGAGCCGCTTGCTGCGGCAGCACGCAGAGGATCTGAACTCAGGGCCCCTGAGC
AAGCTGAGCCTGCTCATCCGGGAACGGCAGCAGCTTCGCAAGACCTACAGCGAGCAGTGG
CAGCAGCTGCAGCAGGAGCTCACCAAGACCCACAGCCAGGACATTGAGAAGCTGAAGAGC
CAGTACCGAGCTCTGGCACGGGACAGTGCCCAAGCCAAGCGCAAGTACCAGGAGGCCAGC
AAAGACAAGGACCGTGACAAGGCTAAGGACAAGTATGTGCGCAGCCTGTGGAAGCTCTTT
GCTCACCACAACCGCTATGTGCTGGGCGTGCGGGCTGCGCAGCTACACCACCAGCACCAC
CACCAGCTCCTGCTGCCCGGCCTGCTGCGGTCACTGCAGGACCTGCACGAGGAGATGGCT
TGCATCCTGAAGGAGATCCTGCAGGAATACCTGGAGATTAGCAGCCTGGTGCAGGATGAG
GTGGTGGCCATTCACCGGGAGATGGCTGCAGCTGCTGCCCGCATCCAGCCTGAGGCTGAG
TACCAAGGCTTCCTGCGACAGTATGGGTCCGCACCTGACGTCCCACCCTGTGTCACGTTC
GATGAGTCACTGCTTGAGGAGGGTGAACCGCTGGAGCCTGGGGAGCTCCAGCTGAACGAG
CTGACTGTGGAGAGCGTGCAGCACACGCTGACCTCAGTGACAGATGAGCTGGCTGTGGCC
ACCGAGATGGTGTTCAGGCGGCAGGAGATGGTTACGCAGCTGCAACAGGAGCTCCGGAAT
GAAGAGGAGAACACCCACCCCCGGGAGCGGGTGCAGCTGCTGGGCAAGAGGCAAGTGCTG
CAAGAAGCACTGCAGGGGCTGCAGGTAGCGCTGTGCAGCCAGGCCAAGCTGCAGGCCCAG
CAGGAGTTGCTGCAGACCAAGCTGGAGCACCTGGGCCCCGGCGAGCCCCCGCCTGTGCTG
CTCCTGCAGGATGACCGCCACTCCACGTCGTCCTCGGAGCAGGAGCGAGAGGGGGGAAGG
ACACCCACGCTGGAGATCCTTAAGAGCCACATCTCAGGAATCTTCCGCCCCAAGTTCTCG
CTCCCTCCACCGCTGCAGCTCATTCCGGAGGTGCAGAAGCCCCTGCATGAGCAGCTGTGG
TACCACGGGGCCATCCCGAGGGCAGAGGTGGCTGAGCTGCTGGTGCACTCTGGGGACTTC
CTGGTGCGGGAGAGCCAGGGCAAGCAGGAGTACGTGCTGTCGGTGCTGTGGGATGGTCTG
CCCCGGCACTTCATCATCCAGTCCTTGGATAACCTGTACCGACTGGAAGGGGAAGGCTTT
CCTAGCATTCCTTTGCTCATCGACCACCTACTGAGCACCCAGCAGCCCCTCACCAAGAAG
AGTGGTGTTGTCCTGCACAGGGCTGTGCCCAAGGACAAGTGGGTGCTGAACCATGAGGAC
CTGGTGTTGGGTGAGCAGATTGGACGGGGGAACTTTGGCGAAGTGTTCAGCGGACGCCTG
CGAGCCGACAACACCCTGGTGGCGGTGAAGTCTTGTCGAGAGACGCTCCCACCTGACCTC
AAGGCCAAGTTTCTACAGGAAGCGAGGATCCTGAAGCAGTACAGCCACCCCAACATCGTG
CGTCTCATTGGTGTCTGCACCCAGAAGCAGCCCATCTACATCGTCATGGAGCTTGTGCAG
GGGGGCGACTTCCTGACCTTCCTCCGCACGGAGGGGGCCCGCCTGCGGGTGAAGACTCTG
CTGCAGATGGTGGGGGATGCAGCTGCTGGCATGGAGTACCTGGAGAGCAAGTGCTGCATC
CACCGGGACCTGGCTGCTCGGAACTGCCTGGTGACAGAGAAGAATGTCCTGAAGATCAGT
GACTTTGGGATGTCCCGAGAGGAAGCCGATGGGGTCTATGCAGCCTCAGGGGGCTCCAGA
CAAGTCCCCGTGAAGTGGACCGCACCTGAGGCCCTTAACTACGGCCGCTACTCCTCCGAA
AGCGACGTGTGGAGCTTTGGCATCTTGCTCTGGGAGACCTTCAGCCTGGGGGCCTCCCCC
TATCCCAACCTCAGCAATCAGCAGACACGGGAGTTTGTGGAGAAGGGGGGCCGTCTGCCC
TGCCCAGAGCTGTGTCCTGATGCCGTGTTCAGGCTCATGGAGCAGTGCTGGGCCTATGAG
CCTGGGCAGCGGCCCAGCTTCAGCACCATCTACCAGGAGCTGCAGAGCATCCGAAAGCGG
CATCGGTGA
Protein Properties
Number of Residues 822
Molecular Weight 93495.9
Theoretical pI 6.72
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Tyrosine-protein kinase Fes/Fps
MGFSSELCSPQGHGVLQQMQEAELRLLEGMRKWMAQRVKSDREYAGLLHHMSLQDSGGQS
RAISPDSPISQSWAEITSQTEGLSRLLRQHAEDLNSGPLSKLSLLIRERQQLRKTYSEQW
QQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLF
AHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDE
VVAIHREMAAAAARIQPEAEYQGFLRQYGSAPDVPPCVTFDESLLEEGEPLEPGELQLNE
LTVESVQHTLTSVTDELAVATEMVFRRQEMVTQLQQELRNEEENTHPRERVQLLGKRQVL
QEALQGLQVALCSQAKLQAQQELLQTKLEHLGPGEPPPVLLLQDDRHSTSSSEQEREGGR
TPTLEILKSHISGIFRPKFSLPPPLQLIPEVQKPLHEQLWYHGAIPRAEVAELLVHSGDF
LVRESQGKQEYVLSVLWDGLPRHFIIQSLDNLYRLEGEGFPSIPLLIDHLLSTQQPLTKK
SGVVLHRAVPKDKWVLNHEDLVLGEQIGRGNFGEVFSGRLRADNTLVAVKSCRETLPPDL
KAKFLQEARILKQYSHPNIVRLIGVCTQKQPIYIVMELVQGGDFLTFLRTEGARLRVKTL
LQMVGDAAAGMEYLESKCCIHRDLAARNCLVTEKNVLKISDFGMSREEADGVYAASGGLR
QVPVKWTAPEALNYGRYSSESDVWSFGILLWETFSLGASPYPNLSNQQTREFVEKGGRLP
CPELCPDAVFRLMEQCWAYEPGQRPSFSTIYQELQSIRKRHR
GenBank ID Protein 29891
UniProtKB/Swiss-Prot ID P07332
UniProtKB/Swiss-Prot Entry Name FES_HUMAN
PDB IDs Not Available
GenBank Gene ID X52192
GeneCard ID FES
GenAtlas ID FES
HGNC ID HGNC:3657
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  4. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  5. Alcalay M, Antolini F, Van de Ven WJ, Lanfrancone L, Grignani F, Pelicci PG: Characterization of human and mouse c-fes cDNA clones and identification of the 5' end of the gene. Oncogene. 1990 Mar;5(3):267-75. [PubMed:2179816 ]
  6. Roebroek AJ, Schalken JA, Verbeek JS, Van den Ouweland AM, Onnekink C, Bloemers HP, Van de Ven WJ: The structure of the human c-fes/fps proto-oncogene. EMBO J. 1985 Nov;4(11):2897-903. [PubMed:4065096 ]
  7. Scott A, Pantoja-Uceda D, Koshiba S, Inoue M, Kigawa T, Terada T, Shirouzu M, Tanaka A, Sugano S, Yokoyama S, Guntert P: Solution structure of the Src homology 2 domain from the human feline sarcoma oncogene Fes. J Biomol NMR. 2005 Apr;31(4):357-61. [PubMed:15929003 ]