Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01500
Secondary Accession Numbers
  • 6796
Name Serine/threonine-protein kinase WNK2
Synonyms
  1. Antigen NY-CO-43
  2. Protein kinase lysine-deficient 2
  3. Protein kinase with no lysine 2
  4. Serologically defined colon cancer antigen 43
Gene Name WNK2
Protein Type Unknown
Biological Properties
General Function Involved in protein kinase activity
Specific Function ATP + a protein = ADP + a phosphoprotein
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein kinase activity
protein serine/threonine kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:9
Locus 9q22.3
SNPs WNK2
Gene Sequence
>6894 bp
ATGGACGGCGATGGCGGCCGCCGAGACGTCCCCGGCACGCTGATGGAGCCCGGGCGCGGC
GCGGGGCCCGCGGGCATGGCGGAGCCTCGGGCGAAGGCGGCGCGGCCGGGGCCCCAGCGC
TTTCTGCGGCGCAGCGTGGTAGAGTCGGACCAGGAGGAGCCGCCGGGCTTGGAGGCAGCC
GAGGCGCCGGGCCCGCAGCCCCCGCAGCCCCTGCAGCGCCGGGTGCTTCTGCTCTGCAAG
ACGCGCCGCCTCATCGCGGAGCGCGCCCGCGGACGCCCCGCCGCCCCCGCGCCCGCAGCG
CTGGTAGCGCAGCCGGGAGCCCCCGGAGCCCCCGCGGACGCCGGCCCCGAGCCCGTGGGC
ACGCAGGAGCCCGGCCCGGACCCCATCGCAGCCGCTGTCGAAACCGCGCCTGCCCCCGAC
GGCGGCCCCAGGGAGGAGGCGGCGGCGACCGTGAGGAAGGAGGATGAGGGGGCGGCCGAG
GCGAAGCCTGAGCCCGGGCGCACTCGCCGGGACGAGCCCGAAGAGGAGGAGGACGACGAG
GACGACCTCAAGGCCGTGGCCACCTCTCTGGACGGCCGCTTCCTCAAGTTCGACATCGAG
CTGGGCCGCGGTTCCTTCAAGACGGTCTACAAGGGGCTGGACACGGAGACCTGGGTGGAG
GTGGCCTGGTGTGAGCTGCAGGACCGGAAGCTCACCAAGCTGGAGCGGCAGCGGTTCAAG
GAAGAGGCTGAGATGCTGAAAGGCCTGCAGCACCCCAACATCGTGCGCTTCTACGACTTC
TGGGAGTCCAGCGCCAAGGGCAAGCGGTGCATTGTGCTGGTGACGGAGCTGATGACCTCA
GGGACGCTGAAGACATACCTGAAGCGGTTCAAGGTGATGAAGCCCAAGGTTCTCCGCAGC
TGGTGCCGGCAGATCCTGAAGGGCCTGCTGTTCCTGCACACAAGGACGCCACCCATCATC
CACCGAGACCTGAAATGTGACAATATTTTCATCACCGGACCAACTGGGTCTGTGAAGATT
GGCGACTTGGGCCTGGCCACTCTGAAAAGAGCGTCATTTGCCAAAAGTGTGATAGGTACT
CCCGAGTTCATGGCGCCCGAGATGTACGAGGAGCACTACGATGAGTCCGTGGACGTCTAT
GCCTTTGGGATGTGCATGCTGGAGATGGCCACCTCGGAGTACCCCTACTCGGAGTGCCAG
AATGCGGCCCAGATCTACCGCAAGGTCACCTGTGGTATCAAGCCGGCCAGCTTTGAGAAA
GTGCACGATCCTGAAATCAAGGAGATTATTGGGGAGTGTATCTGCAAAAACAAGGAGGAA
AGGTACGAGATCAAAGACCTGCTGAGCCACGCCTTCTTCGCAGAGGACACAGGCGTGAGG
GTGGAGCTCGCGGAGGAGGACCACGGCAGGAAGTCCACCATCGCCCTGAGGCTCTGGGTG
GAAGACCCCAAGAAACTGAAGGGAAAGCCCAAGGACAATGGAGCCATAGAGTTCACCTTC
GACCTGGAGAAGGAGACGCCGGATGAGGTGGCCCAAGAGATGATTGAGTCTGGATTCTTC
CACGAGAGTGACGTCAAGATCGTGGCCAAGTCCATCCGTGACCGCGTGGCCTTGATCCAG
TGGCGGCGGGAGAGGATCTGGCCCGCGCTGCAGCCCAAGGAGCAGCAGGATGTGGGCAGC
CCGGACAAGGCCAGGGGTCCGCCGGTGCCCCTGCAGGTCCAGGTGACCTACCATGCACAG
GCTGGGCAGCCCGGGCCACCAGAGCCCGAGGAGCCGGAGGCCGACCAGCACCTCCTGCCA
CCTACGTTGCCGACCAGCGCCACCTCCCTGGCCTCGGACAGCACCTTCGACAGCGGCCAG
GGCTCTACCGTGTACTCAGACTCGCAGAGCAGCCAGCAGAGCGTGATGCTTGGCTCCCTT
GCCGACGCAGCGCCGTCCCCGGCCCAGTGTGTGTGCAGCCCCCCTGTGAGCGAGGGGCCC
GTCCTGCCGCAGAGCCTGCCCTCGCTGGGGGCCTACCAGCAGCCCACGGCTGCACCTGGC
TTGCCGGTGGGCTCTGTCCCGGCCCCCGCCTGCCCTCCGTCCCTCCAGCAGCACTTCCCG
GATCCGGCCATGAGCTTCGCCCCCGTGCTGCCGCCGCCCAGCACCCCCATGCCCACGGGC
CCAGGCCAGCCAGCACCCCCCGGCCAGCAGCCTCCTCCGCTGGCCCAGCCGACACCCCTG
CCGCAGGTCCTGGCCCCACAGCCCGTGGTCCCCCTCCAGCCGGTTCCCCCCCACCTGCCA
CCGTACCTGGCTCCAGCCTCCCAGGTGGGGGCCCCCGCTCAGCTGAAGCCCCTCCAGATG
CCACAGGCGCCCCTGCAGCCGCTTGCTCAAGTCCCTCCGCAGATGCCCCCGATTCCTGTT
GTGCCCCCCATCACGCCCCTGGCGGGAATCGACGGCCTCCCTCCGGCCCTCCCAGACCTG
CCGACCGCGACTGTGCCTCCCGTGCCACCACCTCAGTATTTCTCTCCAGCCGTGATCTTG
CCGAGCCTCGCTGCCCCACTCCCCCCTGCGTCCCCAGCCTTGCCTCTGCAGGCTGTGAAG
CTGCCCCACCCCCCTGGGGCGCCCCTGGCCATGCCCTGCCGGACCATTGTGCCAAATGCA
CCGGCCACTATCCCCCTGCTGGCCGTAGCCCCACCGGGCGTGGCTGCCCTGTCCATTCAT
TCTGCCGTGGCCCAGCTCCCAGGCCAACCTGTGTACCCAGCGGCCTTCCCACAGATGGCG
CCTACTGACGTCCCTCCTTCCCCCCATCACACGGTGCAGAATATGAGGGCCACCCCTCCA
CAGCCGGCACTGCCTCCACAACCCACACTGCCCCCACAACCCGTGCTGCCCCCGCAACCC
ACGCTGCCCCCTCAACCTGTGTTGCCCCCGCAACCCACACGGCCCCCTCAACCTGTGCTG
CCCCCGCAACCCATGCTGCCCCCACAACCTGTGCTGCCCCCGCAGCCGGCACTGCCTGTG
CGCCCTGAGCCCCTCCAGCCCCACCTTCCTGAACAAGCTGCTCCAGCTGCTACACCAGGG
AGCCAGATTCTGCTTGGCCACCCAGCTCCCTATGCTGTGGACGTCGCCGCTCAGGTCCCC
ACCGTGCCTGTGCCACCGGCTGCGGTCCTCTCGCCGCCTCTGCCGGAAGTGCTGCTGCCT
GCCGCCCCTGAGCTCCTGCCTCAGTTCCCCAGCTCCCTGGCCACGGTGTCTGCCTCTGTG
CAGAGTGTGCCCACCCAGACTGCCACACTTCTGCCACCAGCAAACCCACCGCTGCCTGGC
GGGCCCGGGATCGCCAGCCCTTGCCCAACTGTCCAGCTGACGGTGGAACCAGTCCAAGAG
GAGCAGGCCTCACAGGACAAGCCGCCCGGCCTCCCGCAGAGCTGTGAGAGCTATGGAGGT
TCTGATGTCACTTCTGGAAAAGAGCTGAGTGACAGCTGTGAAGGCGCCTTTGGAGGGGGC
AGGCTGGAGGGCAGGGCAGCCCGAAAACACCACCGCAGGTCCACGCGTGCGCGCTCCCGG
CAGGAGAGGGCCAGCCGGCCCCGGCTTACCATCTTGAACGTGTGCAACACTGGGGACAAG
ATGGTGGAGTGCCAGCTGGAGACGCACAACCACAAGATGGTGACCTTCAAGTTCGACTTG
GACGGGGACGCACCCGATGAAATTGCCACGTATATGGTGGAGCATGACTTTATCCTGCAG
GCCGAGCGGGAAACGTTCATCGAGCAGATGAAGGATGTCATGGACAAGGCAGAGGACATG
CTCAGCGAGGACACAGACGCCGACCGTGGCTCCGACCCAGGGACCAGCCCGCCACACCTC
AGCACCTGCGGCCTGGGCACCGGGGAGGAGAGCCGACAATCCCAAGCCAACGCCCCCGTG
TATCAGCAGAACGTCCTGCACACCGGGAAGAGGTGGTTCATCATCTGTCCGGTGGCTGAG
CACCCCGCCCCCGAGGCCCCTGAATCTTCGCCCCCACTTCCTCTAAGCTCCCTGCCGCCA
GAAGCCAGCCAAGGTCCATGCAGGGGGCTCACCCTGCCCTGTCTCCCATGGCGCAGAGCA
GCCTGTGGGGCTGTGTTCCTATCCTTGTTTTCTGCTGAATCAGCTCAGTCAAAGCAGCCT
CCAGATTCAGCGCCCTATAAAGACCAGCTGTCCTCGAAGGAACAACCCAGCTTTCTAGCC
AGTCAGCAGCTCCTGAGCCAGGCGGGCCCCAGCAACCCTCCTGGGGCACCCCCAGCCCCT
TTGGCCCCCTCCTCCCCTCCTGTGACTGCTCTGCCCCAAGATGGAGCAGCTCCAGCCACC
AGCACCATGCCAGAGCCAGCGTCAGGAACTGCCAGCCAGGCAGGGGGTCCAGGGACACCT
CAGGGGCTGACCAGTGAGCTCGAGACGTCTCAGCCACTAGCGGAGACTCACGAGGCCCCG
CTTGCTGTGCAGCCCCTCGTGGTGGGCCTAGCACCTTGCACTCCAGCTCCAGAGGCTGCC
TCAACCAGGGACGCCAGTGCCCCAAGGGAGCCCCTGCCACCTCCTGCACCTGAGCCCAGC
CCCCACAGCGGGACCCCACAGCCCGCCTTGGGTCAACCTGCTCCCCTGCTTCCTGCCGCA
GTGGGGGCCGTCAGCCTGGCCACCTCCCAGCTCCCAAGCCCACCCCTGGGGCCCACCGTC
CCCCCACAGCCACCCTCGGCCCTGGAGTCGGATGGGGAAGGGCCGCCCCCCAGGGTGGGC
TTTGTGGACAGCACCATCAAGAGCCTGGACGAGAAGCTGCGGACTCTGCTCTACCAGGAG
CACGTGCCCACCTCCTCAGCCTCAGCTGGGACCCCTGTGGAGGTGGGCGACAGAGACTTC
ACCCTGGAGCCCCTGAGAGGGGACCAGCCCCGCTCAGAGGTCTGCGGGGGGGACCTGGCC
CTGCCCCCAGTGCCTAAGGAGGCGGTCTCAGGGCGTGTCCAGCTGCCCCAGCCCTTGGTG
GAGAAGTCAGAACTGGCCCCCACTCGAGGGGCCGTGATGGAGCAGGGCACGTCCTCGTCA
ATGACAGCAGAGTCGTCTCCCAGGAGTATGCTAGGCTATGACAGAGATGGAAGGCAGGTG
GCCTCAGACTCCCATGTGGTCCCCAGCGTCCCCCAGGATGTACCTGCTTTTGTGAGACCT
GCACGTGTGGAGCCCACAGACAGGGATGGTGGAGAAGCTGGAGAAAGCTCGGCAGAGCCC
CCGCCGAGTGACATGGGCACAGTGGGGGGCCAGGCTAGCCACCCCCAGACACTCGGCGCT
CGAGCTTTGGGGTCCCCTCGGAAACGTCCAGAGCAGCAGGATGTCAGCTCACCAGCCAAG
ACTGTGGGCCGTTTCTCGGTGGTCAGCACTCAGGACGAGTGGACCCTGGCCTCCCCCCAC
AGCCTGAGATACTCTGCCCCACCCGACGTCTACCTGGACGAGGCCCCCTCCAGCCCCGAC
GTGAAGCTGGCAGTGCGGCGGGCGCAGACGGCCTCCTCCATCGAGGTCGGCGTGGGCGAG
CCCGTGTCCAGCGACTCTGGGGACGAGGGCCCTCGGGCGAGACCCCCGGTGCAGAAGCAG
GCGTCCCTGCCCGTGAGTGGCAGCGTGGCTGGCGACTTCGTGAAGAAGGCCACCGCCTTC
CTGCAGAGGCCTTCTCGGGCCGGCTCGCTGGGCCCCGAGACACCCAGCAGGGTGGGCATG
AAGGTCCCCACGATCAGCGTGACCTCCTTCCATTCCCAGTCGTCCTACATCAGCAGCGAC
AATGATTCGGAGCTCGAGGATGCTGACATAAAGAAGGAGCTGCAGAGTCTGCGGGAGAAG
CACCTGAAGGAGATCTCGGAGCTGCAGAGCCAGCAGAAGCAGGAGATCGAAGCTCTGTAC
CGCCGCCTGGGCAAGCCACTGCCCCCCAACGTGGGCTTCTTCCACACGGCACCCCCCACT
GGCCGCCGGAGAAAAACCAGCAAGAGCAAGCTGAAGGCAGGCAAGCTGCTAAATCCCCTG
GTGCGGCAGCTCAAGGTCGTGGCCTCCAGCACAGGTCACTTGGCTGACTCCAGCAGAGGC
CCTCCCGCTAAGGACCCTGCCCAAGCCAGTGTGGGGCTCACTGCAGACAGCACGGGCCTG
AGCGGGAAGGCAGTGCAGACCCAGCAGCCCTGCTCCGTCCGGGCCTCCCTGTCTTCGGAC
ATCTGCTCCGGCTTAGCCAGTGATGGAGGCGGAGCGCGTGGCCAAGGCTGGACGGTTTAC
CACCCAACGTCTGAGAGAGTGACCTATAAGTCTAGTAGCAAACCTCGTGCTCGATTCCTC
AGTGGACCCGTATCTGTGTCCATCTGGTCTGCCCTGAAGCGTCTCTGCCTAGGCAAAGAA
CACAGCAGTAGGTCCTCCACCAGCAGCCTGGCCCCAGGCCCTGAGCCAGGCCCCCAGCCC
GCCCTGCACGTCCAGGCGCAGGTGAACAACAGCAACAACAAGAAGGGTACCTTCACGGAC
GACCTGCACAAGCTGGTGGACGAGTGGACGAGCAAGACGGTGGGGGCCGCGCAGCTGAAG
CCCACGCTCAACCAGCTGAAGCAGACCCAGAAGCTGCAAGACATGGAGGCCCAGGCAGGC
TGGGCTGCCCCTGGCGAGGCGCGGGCTATGACCGCACCTCGAGCAGGAGTGGGGATGCCA
CGTCTGCCCCCAGCGCCCGGCCCTCTGTCCACCACGGTCATTCCCGGAGCCGCCCCGACC
CTGTCCGTGCCCACACCAGATGGCGCCCTCGGAACCGCCCGGAGAAACCAGGTGTGGTTT
GGCCTCCGAGTCCCCCCCACCGCCTGCTGTGGGCACAGCACTCAGCCGCGAGGGGGACAG
CGGGTGGGCAGCAAGACTGCTTCCTTTGCGGCTTCAGACCCTGTTCGCTCCTAG
Protein Properties
Number of Residues 2297
Molecular Weight 242673.8
Theoretical pI 6.03
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Serine/threonine-protein kinase WNK2
MDGDGGRRDVPGTLMEPGRGAGPAGMAEPRAKAARPGPQRFLRRSVVESDQEEPPGLEAA
EAPGPQPPQPLQRRVLLLCKTRRLIAERARGRPAAPAPAALVAQPGAPGAPADAGPEPVG
TQEPGPDPIAAAVETAPAPDGGPREEAAATVRKEDEGAAEAKPEPGRTRRDEPEEEEDDE
DDLKAVATSLDGRFLKFDIELGRGSFKTVYKGLDTETWVEVAWCELQDRKLTKLERQRFK
EEAEMLKGLQHPNIVRFYDFWESSAKGKRCIVLVTELMTSGTLKTYLKRFKVMKPKVLRS
WCRQILKGLLFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLKRASFAKSVIGT
PEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKVTCGIKPASFEK
VHDPEIKEIIGECICKNKEERYEIKDLLSHAFFAEDTGVRVELAEEDHGRKSTIALRLWV
EDPKKLKGKPKDNGAIEFTFDLEKETPDEVAQEMIESGFFHESDVKIVAKSIRDRVALIQ
WRRERIWPALQPKEQQDVGSPDKARGPPVPLQVQVTYHAQAGQPGPPEPEEPEADQHLLP
PTLPTSATSLASDSTFDSGQGSTVYSDSQSSQQSVMLGSLADAAPSPAQCVCSPPVSEGP
VLPQSLPSLGAYQQPTAAPGLPVGSVPAPACPPSLQQHFPDPAMSFAPVLPPPSTPMPTG
PGQPAPPGQQPPPLAQPTPLPQVLAPQPVVPLQPVPPHLPPYLAPASQVGAPAQLKPLQM
PQAPLQPLAQVPPQMPPIPVVPPITPLAGIDGLPPALPDLPTATVPPVPPPQYFSPAVIL
PSLAAPLPPASPALPLQAVKLPHPPGAPLAMPCRTIVPNAPATIPLLAVAPPGVAALSIH
SAVAQLPGQPVYPAAFPQMAPTDVPPSPHHTVQNMRATPPQPALPPQPTLPPQPVLPPQP
TLPPQPVLPPQPTRPPQPVLPPQPMLPPQPVLPPQPALPVRPEPLQPHLPEQAAPAATPG
SQILLGHPAPYAVDVAAQVPTVPVPPAAVLSPPLPEVLLPAAPELLPQFPSSLATVSASV
QSVPTQTATLLPPANPPLPGGPGIASPCPTVQLTVEPVQEEQASQDKPPGLPQSCESYGG
SDVTSGKELSDSCEGAFGGGRLEGRAARKHHRRSTRARSRQERASRPRLTILNVCNTGDK
MVECQLETHNHKMVTFKFDLDGDAPDEIATYMVEHDFILQAERETFIEQMKDVMDKAEDM
LSEDTDADRGSDPGTSPPHLSTCGLGTGEESRQSQANAPVYQQNVLHTGKRWFIICPVAE
HPAPEAPESSPPLPLSSLPPEASQGPCRGLTLPCLPWRRAACGAVFLSLFSAESAQSKQP
PDSAPYKDQLSSKEQPSFLASQQLLSQAGPSNPPGAPPAPLAPSSPPVTALPQDGAAPAT
STMPEPASGTASQAGGPGTPQGLTSELETSQPLAETHEAPLAVQPLVVGLAPCTPAPEAA
STRDASAPREPLPPPAPEPSPHSGTPQPALGQPAPLLPAAVGAVSLATSQLPSPPLGPTV
PPQPPSALESDGEGPPPRVGFVDSTIKSLDEKLRTLLYQEHVPTSSASAGTPVEVGDRDF
TLEPLRGDQPRSEVCGGDLALPPVPKEAVSGRVQLPQPLVEKSELAPTRGAVMEQGTSSS
MTAESSPRSMLGYDRDGRQVASDSHVVPSVPQDVPAFVRPARVEPTDRDGGEAGESSAEP
PPSDMGTVGGQASHPQTLGARALGSPRKRPEQQDVSSPAKTVGRFSVVSTQDEWTLASPH
SLRYSAPPDVYLDEAPSSPDVKLAVRRAQTASSIEVGVGEPVSSDSGDEGPRARPPVQKQ
ASLPVSGSVAGDFVKKATAFLQRPSRAGSLGPETPSRVGMKVPTISVTSFHSQSSYISSD
NDSELEDADIKKELQSLREKHLKEISELQSQQKQEIEALYRRLGKPLPPNVGFFHTAPPT
GRRRKTSKSKLKAGKLLNPLVRQLKVVASSTGHLADSSRGPPAKDPAQASVGLTADSTGL
SGKAVQTQQPCSVRASLSSDICSGLASDGGGARGQGWTVYHPTSERVTYKSSSKPRARFL
SGPVSVSIWSALKRLCLGKEHSSRSSTSSLAPGPEPGPQPALHVQAQVNNSNNKKGTFTD
DLHKLVDEWTSKTVGAAQLKPTLNQLKQTQKLQDMEAQAGWAAPGEARAMTAPRAGVGMP
RLPPAPGPLSTTVIPGAAPTLSVPTPDGALGTARRNQVWFGLRVPPTACCGHSTQPRGGQ
RVGSKTASFAASDPVRS
GenBank ID Protein 57161866
UniProtKB/Swiss-Prot ID Q9Y3S1
UniProtKB/Swiss-Prot Entry Name WNK2_HUMAN
PDB IDs Not Available
GenBank Gene ID AJ242724
GeneCard ID WNK2
GenAtlas ID WNK2
HGNC ID HGNC:14542
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  4. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  5. Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. [PubMed:15164053 ]
  6. Nagase T, Kikuno R, Hattori A, Kondo Y, Okumura K, Ohara O: Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 2000 Dec 31;7(6):347-55. [PubMed:11214970 ]
  7. Verissimo F, Jordan P: WNK kinases, a novel protein kinase subfamily in multi-cellular organisms. Oncogene. 2001 Sep 6;20(39):5562-9. [PubMed:11571656 ]
  8. Ito M, Shichijo S, Tsuda N, Ochi M, Harashima N, Saito N, Itoh K: Molecular basis of T cell-mediated recognition of pancreatic cancer cells. Cancer Res. 2001 Mar 1;61(5):2038-46. [PubMed:11280764 ]