You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01510
Secondary Accession Numbers
  • 6806
Name Tyrosine-protein kinase Srms
Synonyms Not Available
Gene Name SRMS
Protein Type Enzyme
Biological Properties
General Function Involved in protein kinase activity
Specific Function May be involved in proliferation or differentiation of keratinocytes in the skin
Pathways Not Available
Reactions Not Available
GO Classification
Function
protein tyrosine kinase activity
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein binding
protein kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location Not Available
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs SRMS
Gene Sequence
>1467 bp
TCAGGGGTGGCATCTGTGGATGGCGTGCAGCTTCTCCCGCAGCGTGGCGAAGGAGGGCCG
TTCCTCGGGGCTGCTCCTCCAGCACTCCAGCATGAGCACGTAGACCTCCGCCGGGCAGGC
AGCCGGGCGCGGCAGCCGGTACCCTCGCATGATCTGCTGCAGCGTCTCGTGGTTGGTCAT
CCCTTCATAGGGACACTGGCCATAGGTGAAAACCTCGTGCAGCAGGACGCCGAAGGACCA
GACGTCTGACTTCTGGGAGAAGACACGATAATTGGCCGCCTCAGGCGCTGTCCACTTGAC
CGGGATCTTGGAGCTGCTGCTCGGGGAGTAGATGTCGTCCTTGAGCAGCCGGGCCAGGCC
GAAGTCAGCCACCTTGCAGGCCAGGCCGTCGTCCACGAGCACGTTCCGGGCGGCCAAGTC
CCGGTGCACAACGCGCTGCTCCTCCAGGTAGCTCATGCCCTCAGCCACCTGGCAGGCAAA
GCCCAGGAGTGGCGGCAGACGCAGGGCCCGGCCCTCGGGGGTGCCCAGGAAGGCCTGCAG
GTTCCCCTTGCGCATGAGTTCCGTGACGATGTACACAGGCTCCCCGCCCGAGCACACTGC
GTGCAGCCGGATGAGCCGCTCGTGCCGCAGGCCCTTCAGTGTCTGGATCTCCTTGGCGAG
GTCAGTGAGCTTCATGTTGGCTGACTTGATGACCTTGATCGCCACGGGCAGGGAGCCCAG
CCACAGGCCTTCCCACACCTCCCCAAAGTAGCCTTCACCCAGCTTCCTCCCAAGGGCGAA
TTCGGAGTGTGGCCGCTCCCACACGTCCTGCCTCGGGGCCTTCTGGGGCATGCAGGGCTG
CAGCAGGGGGTTCTGGATCAGCTTCCAGTTGGCCTTGTAGTAGGTGAGCAGCTCCTCCAG
GCCGGGAAAGAGCCGTCCCTTCTGCAGGTAGAGGCTGCCATCAGCTGCCATGGAGACCCG
GTAGTGGCAGACCTTGGCCTGGGCCCGGACTGACAGTGAGTAGCCCCCGAGGCTGCTCTC
GCTGGGCCGGATGAGGAAGGCCCCTGGTTCGTTGGGTGGGGAGAGGAGCAGCTGCTGTGC
CTGGGTCCGACTGACCCCGCTAAAGTACCAGGGTTGGTCTGAGAGCGTCTCAGGAGAAGC
CTTGGCCACGTGGGTGATGGGCACGAGCCCGGCGCTGGGCTGGCCCGAAAGCCTGCGTGC
GAAGATGTAGCCGCCCCCCTCTTCGAGGGCACAGAGCCTGTCCCCGCGGCGGACACTCAG
CTCCCCGCCACACCGCGCCGTGAAGTCATAGAGCGCAAGGAAGAGCTGAGGGAAGGGGCT
GCAAGGCTCGGCGGGGAGCGTGGGCACTGGGTCAGTGTTGGGGTCCAGGGACCCGGGGGT
GCCATGGTCCGGCTCGCCGCCCGCCGGCCAGATCTTGTCCCAGAAGAAGGACAGGAAGGC
CAGCCGCCTCCTGAGGAACGGCTCCAT
Protein Properties
Number of Residues 488
Molecular Weight 54506.3
Theoretical pI 8.29
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Tyrosine-protein kinase Srms
MEPFLRRRLAFLSFFWDKIWPAGGEPDHGTPGSLDPNTDPVPTLPAEPCSPFPQLFLALY
DFTARCGGELSVRRGDRLCALEEGGGYIFARRLSGQPSAGLVPITHVAKASPETLSDQPW
YFSGVSRTQAQQLLLSPPNEPGAFLIRPSESSLGGYSLSVRAQAKVCHYRVSMAADGSLY
LQKGRLFPGLEELLTYYKANWKLIQNPLLQPCMPQKAPRQDVWERPHSEFALGRKLGEGY
FGEVWEGLWLGSLPVAIKVIKSANMKLTDLAKEIQTLKGLRHERLIRLHAVCSGGEPVYI
VTELMRKGNLQAFLGTPEGRALRLPPLLGFACQVAEGMSYLEEQRVVHRDLAARNVLVDD
GLACKVADFGLARLLKDDIYSPSSSSKIPVKWTAPEAANYRVFSQKSDVWSFGVLLHEVF
TYGQCPYEGMTNHETLQQIMRGYRLPRPAACPAEVYVLMLECWRSSPEERPSFATLREKL
HAIHRCHP
GenBank ID Protein 11137518
UniProtKB/Swiss-Prot ID Q9H3Y6
UniProtKB/Swiss-Prot Entry Name SRMS_HUMAN
PDB IDs Not Available
GenBank Gene ID AL121829
GeneCard ID SRMS
GenAtlas ID SRMS
HGNC ID HGNC:11298
References
General References
  1. Deloukas P, Matthews LH, Ashurst J, Burton J, Gilbert JG, Jones M, Stavrides G, Almeida JP, Babbage AK, Bagguley CL, Bailey J, Barlow KF, Bates KN, Beard LM, Beare DM, Beasley OP, Bird CP, Blakey SE, Bridgeman AM, Brown AJ, Buck D, Burrill W, Butler AP, Carder C, Carter NP, Chapman JC, Clamp M, Clark G, Clark LN, Clark SY, Clee CM, Clegg S, Cobley VE, Collier RE, Connor R, Corby NR, Coulson A, Coville GJ, Deadman R, Dhami P, Dunn M, Ellington AG, Frankland JA, Fraser A, French L, Garner P, Grafham DV, Griffiths C, Griffiths MN, Gwilliam R, Hall RE, Hammond S, Harley JL, Heath PD, Ho S, Holden JL, Howden PJ, Huckle E, Hunt AR, Hunt SE, Jekosch K, Johnson CM, Johnson D, Kay MP, Kimberley AM, King A, Knights A, Laird GK, Lawlor S, Lehvaslaiho MH, Leversha M, Lloyd C, Lloyd DM, Lovell JD, Marsh VL, Martin SL, McConnachie LJ, McLay K, McMurray AA, Milne S, Mistry D, Moore MJ, Mullikin JC, Nickerson T, Oliver K, Parker A, Patel R, Pearce TA, Peck AI, Phillimore BJ, Prathalingam SR, Plumb RW, Ramsay H, Rice CM, Ross MT, Scott CE, Sehra HK, Shownkeen R, Sims S, Skuce CD, Smith ML, Soderlund C, Steward CA, Sulston JE, Swann M, Sycamore N, Taylor R, Tee L, Thomas DW, Thorpe A, Tracey A, Tromans AC, Vaudin M, Wall M, Wallis JM, Whitehead SL, Whittaker P, Willey DL, Williams L, Williams SA, Wilming L, Wray PW, Hubbard T, Durbin RM, Bentley DR, Beck S, Rogers J: The DNA sequence and comparative analysis of human chromosome 20. Nature. 2001 Dec 20-27;414(6866):865-71. [PubMed:11780052 ]
  2. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]