Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01522
Secondary Accession Numbers
  • 6818
Name Cell division protein kinase 11B
Synonyms
  1. CLK-1
  2. Cell division cycle 2-like protein kinase 1
  3. Galactosyltransferase-associated protein kinase p58/GTA
  4. PITSLRE serine/threonine-protein kinase CDC2L1
  5. p58 CLK-1
Gene Name CDK11B
Protein Type Unknown
Biological Properties
General Function Involved in protein kinase activity
Specific Function Appears to play multiple roles in cell cycle progression, cytokinesis and apoptosis. The p110 isoforms have been suggested to be involved in pre-mRNA splicing, potentially by phosphorylating the splicing protein SFRS7. The p58 isoform may act as a negative regulator of normal cell cycle progression
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein kinase activity
protein serine/threonine kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location
  1. Nucleus
  2. Cytoplasm
Gene Properties
Chromosome Location Chromosome:1
Locus 1p36.33
SNPs CDK11B
Gene Sequence
>2388 bp
ATGGGTGATGAAAAGGACTCTTGGAAAGTGAAAACTTTAGATGAAATTCTTCAGGAAAAG
AAACGAAGGAAGGAACAAGAGGAGAAAGCAGAGATAAAACGCTTAAAAAATTCTGATGAC
CGGGATTCCAAGCGGGATTCCCTTGAGGAGGGGGAGCTGAGAGATCACCGCATGGAGATC
ACAATAAGGAACTCCCCGTATAGAAGAGAAGACTCTATGGAAGACAGAGGAGAAGAAGAT
GATTCTTTGGCCATCAAACCACCCCAGCAAATGTCTCGGAAAGAAAAAGTTCATCACAGA
AAAGATGAAAAGAGAAAAGAGAAACGTAGGCATCGTAGCCATTCAGCAGAAGGGGGGAAG
CATGCTAGAGTGAAAGAAAAAGAAAGAGAGCACGAACGTCGGAAACGACATCGAGAAGAA
CAGGATAAAGCTCGCCGGGAATGGGAAAGACAGAAGAGAAGGGAAATGGCAAGGGAGCAT
TCCAGGAGAGAAAGGGACCGCTTGGAGCAGTTAGAAAGGAAGCGGGAGCGGGAGCGCAAG
ATGCGGGAGCAGCAGAAGGAGCAGCGGGAGCAGAAGGAGCGCGAGCGGCGGGCGGAGGAG
CGGCGCAAGGAGCGGGAGGCCCGCAGGGAAGTGTCTGCACATCACCGAACGATGAGAGAG
GACTACAGCGACAAAGTGAAAGCCAGCCACTGGAGTCGCAGCCCGCCTCGGCCGCCGCGG
GAGCGGTTCGAGTTGGGAGACGGCCGGAAGCCAGGTGAGGCCAGGCCGGCGCGTGCGCAG
AAGCCAGCACAGTTAAAAGAAGAGAAAATGGAAGAAAGGGACCTGCTGTCCGACTTACAG
GACATCAGCGACAGCGAGAGGAAGACCAGCTCGGCCGAGTCCTCGTCAGCAGAATCAGGC
TCAGGTTCTGAGGAAGAAGAGGAGGAGGAGGAAGAGGAGGAGGAGGAAGGGAGCACCAGT
GAAGAATCAGAGGAGGAGGAGGAGGAAGAGGAAGAGGAGGAGGAGGAGACCGGCAGCAAC
TCTGAGGAGGCATCAGAGCAGTCTGCCGAAGAAGTAAGTGAGGAAGAAATGAGTGAAGAT
GAAGAACGAGAAAATGAAAACCACCTCTTGGTTGTTCCAGAGTCACGGTTCGACCGAGAT
TCCGGGGAGAGTGAAGAAGCAGAGGAAGAAGTGGGTGAGGGAACGCCGCAGAGCAGCGCC
CTGACAGAGGGCGACTATGTGCCCGACTCCCCTGCCCTGTCGCCCATCGAGCTCAAGCAG
GAGCTGCCCAAGTACCTGCCGGCCCTGCAGGGCTGCCGGAGCGTCGAGGAGTTCCAGTGC
CTGAACAGGATCGAGGAGGGCACCTATGGAGTGGTCTACAGAGCAAAAGACAAGAAAACA
GATGAAATTGTGGCTCTAAAGCGGCTGAAGATGGAGAAGGAGAAGGAGGGCTTCCCGATC
ACGTCGCTGAGGGAGATCAACACCATCCTCAAGGCCCAGCATCCCAACATCGTCACCGTT
AGAGAGATTGTGGTGGGCAGCAACATGGACAAGATCTACATCGTGATGAACTATGTGGAG
CACGACCTCAAGAGCCTGATGGAGACCATGAAACAGCCCTTCCTGCCAGGGGAGGTGAAG
ACCCTGATGATCCAGCTGCTGCGTGGGGTGAAACACCTGCACGACAACTGGATCCTGCAC
CGTGACCTCAAGACGTCCAACCTGCTGCTGAGCCACGCCGGCATCCTCAAGGTGGGTGAC
TTCGGGCTGGCGCGGGAGTACGGATCCCCTCTGAAGGCCTACACCCCGGTCGTGGTGACC
CTGTGGTACCGCGCCCCAGAGCTGCTGCTTGGTGCCAAGGAATACTCCACGGCCGTGGAC
ATGTGGTCAGTGGGTTGCATCTTCGGGGAGCTGCTGACTCAGAAGCCTCTGTTCCCCGGG
AAGTCAGAAATCGATCAGATCAACAAGGTGTTCAAGGATCTGGGGACCCCTAGTGAGAAA
ATCTGGCCCGGCTACAGCGAGCTCCCAGCAGTCAAGAAGATGACCTTCAGCGAGCACCCC
TACAACAACCTCCGCAAGCGCTTCGGGGCTCTGCTCTCAGACCAGGGCTTCGACCTCATG
AACAAGTTCCTGACCTACTTCCCCGGGAGGAGGATCAGCGCTGAGGACGGCCTCAAGCAT
GAGTATTTCCGCGAGACCCCCCTCCCCATCGACCCCTCCATGTTCCCCACGTGGCCCGCC
AAGAGCGAGCAGCAGCGTGTGAAGCGGGGCACCAGCCCGAGGCCCCCTGAGGGAGGCCTG
GGCTACAGCCAGCTGGGTGACGACGACCTGAAGGAGACGGGCTTCCACCTTACCACCACG
AACCAGGGGGCCTCTGCCGCGGGCCCCGGCTTCAGCCTCAAGTTCTGA
Protein Properties
Number of Residues 795
Molecular Weight 92706.3
Theoretical pI 5.27
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Cell division protein kinase 11B
MGDEKDSWKVKTLDEILQEKKRRKEQEEKAEIKRLKNSDDRDSKRDSLEEGELRDHRMEI
TIRNSPYRREDSMEDRGEEDDSLAIKPPQQMSRKEKVHHRKDEKRKEKRRHRSHSAEGGK
HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERK
MREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASHWSRSPPRPPR
ERFELGDGRKPGEARPARAQKPAQLKEEKMEERDLLSDLQDISDSERKTSSAESSSAESG
SGSEEEEEEEEEEEEEGSTSEESEEEEEEEEEEEEETGSNSEEASEQSAEEVSEEEMSED
EERENENHLLVVPESRFDRDSGESEEAEEEVGEGTPQSSALTEGDYVPDSPALSPIELKQ
ELPKYLPALQGCRSVEEFQCLNRIEEGTYGVVYRAKDKKTDEIVALKRLKMEKEKEGFPI
TSLREINTILKAQHPNIVTVREIVVGSNMDKIYIVMNYVEHDLKSLMETMKQPFLPGEVK
TLMIQLLRGVKHLHDNWILHRDLKTSNLLLSHAGILKVGDFGLAREYGSPLKAYTPVVVT
LWYRAPELLLGAKEYSTAVDMWSVGCIFGELLTQKPLFPGKSEIDQINKVFKDLGTPSEK
IWPGYSELPAVKKMTFSEHPYNNLRKRFGALLSDQGFDLMNKFLTYFPGRRISAEDGLKH
EYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDLKETGFHLTTT
NQGASAAGPGFSLKF
GenBank ID Protein 3850310
UniProtKB/Swiss-Prot ID P21127
UniProtKB/Swiss-Prot Entry Name CD11B_HUMAN
PDB IDs Not Available
GenBank Gene ID AF067515
GeneCard ID CDK11B
GenAtlas ID CDK11B
HGNC ID HGNC:1729
References
General References
  1. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  2. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  3. Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP: Large-scale characterization of HeLa cell nuclear phosphoproteins. Proc Natl Acad Sci U S A. 2004 Aug 17;101(33):12130-5. Epub 2004 Aug 9. [PubMed:15302935 ]
  4. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  5. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  6. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243 ]
  7. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  8. Wang B, Malik R, Nigg EA, Korner R: Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis. Anal Chem. 2008 Dec 15;80(24):9526-33. doi: 10.1021/ac801708p. [PubMed:19007248 ]
  9. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  10. Carrascal M, Ovelleiro D, Casas V, Gay M, Abian J: Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment. J Proteome Res. 2008 Dec;7(12):5167-76. [PubMed:19367720 ]
  11. Bunnell BA, Heath LS, Adams DE, Lahti JM, Kidd VJ: Increased expression of a 58-kDa protein kinase leads to changes in the CHO cell cycle. Proc Natl Acad Sci U S A. 1990 Oct;87(19):7467-71. [PubMed:2217177 ]
  12. Lake JA, de la Cruz VF, Ferreira CG, Morel C, Simpson L: Evolution of parasitism: kinetoplastid protozoan history reconstructed from mitochondrial rRNA gene sequences. Proc Natl Acad Sci U S A. 1991 Mar 15;88(6):2612. [PubMed:2006197 ]
  13. Eipers PG, Lahti JM, Kidd VJ: Structure and expression of the human p58clk-1 protein kinase chromosomal gene. Genomics. 1992 Jul;13(3):613-21. [PubMed:1639388 ]
  14. Xiang J, Lahti JM, Grenet J, Easton J, Kidd VJ: Molecular cloning and expression of alternatively spliced PITSLRE protein kinase isoforms. J Biol Chem. 1994 Jun 3;269(22):15786-94. [PubMed:8195233 ]
  15. Gururajan R, Lahti JM, Grenet J, Easton J, Gruber I, Ambros PF, Kidd VJ: Duplication of a genomic region containing the Cdc2L1-2 and MMP21-22 genes on human chromosome 1p36.3 and their linkage to D1Z2. Genome Res. 1998 Sep;8(9):929-39. [PubMed:9750192 ]
  16. Loyer P, Trembley JH, Lahti JM, Kidd VJ: The RNP protein, RNPS1, associates with specific isoforms of the p34cdc2-related PITSLRE protein kinase in vivo. J Cell Sci. 1998 Jun;111 ( Pt 11):1495-506. [PubMed:9580558 ]
  17. Cornelis S, Bruynooghe Y, Denecker G, Van Huffel S, Tinton S, Beyaert R: Identification and characterization of a novel cell cycle-regulated internal ribosome entry site. Mol Cell. 2000 Apr;5(4):597-605. [PubMed:10882096 ]
  18. Mikolajczyk M, Shi J, Vaillancourt RR, Sachs NA, Nelson M: The cyclin-dependent kinase 11(p46) isoform interacts with RanBPM. Biochem Biophys Res Commun. 2003 Oct 10;310(1):14-8. [PubMed:14511641 ]
  19. Hu D, Mayeda A, Trembley JH, Lahti JM, Kidd VJ: CDK11 complexes promote pre-mRNA splicing. J Biol Chem. 2003 Mar 7;278(10):8623-9. Epub 2002 Dec 24. [PubMed:12501247 ]
  20. Chen S, Yin X, Zhu X, Yan J, Ji S, Chen C, Cai M, Zhang S, Zong H, Hu Y, Yuan Z, Shen Z, Gu J: The C-terminal kinase domain of the p34cdc2-related PITSLRE protein kinase (p110C) associates with p21-activated kinase 1 and inhibits its activity during anoikis. J Biol Chem. 2003 May 30;278(22):20029-36. Epub 2003 Mar 6. [PubMed:12624090 ]