You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Showing Protein ATP synthase subunit f, mitochondrial (HMDBP01532)
Identification | |
---|---|
HMDB Protein ID | HMDBP01532 |
Secondary Accession Numbers |
|
Name | ATP synthase subunit f, mitochondrial |
Synonyms | Not Available |
Gene Name | ATP5J2 |
Protein Type | Enzyme |
Biological Properties | |
General Function | Involved in transmembrane transporter activity |
Specific Function | Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane |
Pathways | Not Available |
Reactions | Not Available |
GO Classification | Not Available |
Cellular Location |
|
Gene Properties | |
Chromosome Location | Chromosome:7 |
Locus | 7q22.1 |
SNPs | ATP5J2 |
Gene Sequence |
>285 bp ATGGCGTCAGTTGGTGAGTGTCCGGCCCCAGTACCAGTGAAGGACAAGAAACTTCTGGAG GTCAAACTGGGGGAGCTGCCAAGCTGGATCTTGATGCGGGACTTCAGTCCTAGTGGCATT TTCGGAGCGTTTCAAAGAGGTTACTACCGGTACTACAACAAGTACATCAATGTGAAGAAG GGGAGCATCTCGGGGATTACCATGGTGCTGGCATGCTACGTGCTCTTTAGCTACTCCTTT TCCTACAAGCATCTCAAGCACGAGCGGCTCCGCAAATACCACTGA |
Protein Properties | |
Number of Residues | 94 |
Molecular Weight | 10917.8 |
Theoretical pI | 10.09 |
Pfam Domain Function |
|
Signals |
|
Transmembrane Regions |
|
Protein Sequence |
>ATP synthase subunit f, mitochondrial MASVGECPAPVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKK GSISGITMVLACYVLFSYSFSYKHLKHERLRKYH |
External Links | |
GenBank ID Protein | 3335128 |
UniProtKB/Swiss-Prot ID | P56134 |
UniProtKB/Swiss-Prot Entry Name | ATPK_HUMAN |
PDB IDs | Not Available |
GenBank Gene ID | AF047436 |
GeneCard ID | ATP5J2 |
GenAtlas ID | ATP5J2 |
HGNC ID | HGNC:848 |
References | |
General References |
|