You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01542
Secondary Accession Numbers
  • 6838
Name Alkyldihydroxyacetonephosphate synthase, peroxisomal
Synonyms
  1. Aging-associated gene 5 protein
  2. Alkyl-DHAP synthase
  3. Alkylglycerone-phosphate synthase
Gene Name AGPS
Protein Type Unknown
Biological Properties
General Function Involved in catalytic activity
Specific Function 1-acyl-glycerone 3-phosphate + a long-chain alcohol = an alkyl-glycerone 3-phosphate + a long-chain acid anion
Pathways
  • Plasmalogen Synthesis
Reactions Not Available
GO Classification
Function
binding
catalytic activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
oxidoreductase activity
fad or fadh2 binding
Cellular Location
  1. Peroxisome membrane
Gene Properties
Chromosome Location Chromosome:2
Locus 2q31.2
SNPs AGPS
Gene Sequence
>1977 bp
ATGGCGGAGGCGGCGGCTGCAGCGGGTGGGACTGGCTTGGGCGCGGGCGCGAGCTACGGG
TCTGCAGCGGACCGGGACCGGGACCCGGACCCGGACCGCGCCGGGCGGAGGCTGCGGGTT
CTCTCTGGCCATCTGCTGGGCCGGCCCCGGGAGGCTCTGAGTACCAATGAGTGCAAAGCG
CGGAGAGCCGCGTCGGCGGCCACGGCAGCGCCCACGGCCACTCCCGCCGCGCAGGAGTCG
GGCACCATCCCAAAGAAGCGGCAAGAAGTTATGAAATGGAATGGATGGGGATATAATGAT
TCTAAATTCATCTTCAATAAGAAGGGCCAAATTGAATTGACTGGGAAAAGGTACCCTCTT
AGTGGCATGGGTTTACCAACATTTAAAGAATGGATCCAAAATACCCTTGGAGTAAATGTG
GAGCATAAAACTACCTCTAAAGCATCCTTAAATCCTAGTGATACACCTCCTTCTGTTGTA
AATGAAGATTTTCTTCATGACCTTAAAGAAACTAATATTTCATATTCACAAGAGGCAGAT
GATCGAGTATTTAGAGCTCATGGTCATTGTCTTCATGAGATATTTTTGCTCAGGGAAGGA
ATGTTTGAGCGAATTCCTGATATAGTTTTATGGCCAACATGCCATGATGATGTAGTTAAG
ATTGTGAATCTAGCTTGCAAATATAATCTTTGTATCATACCAATTGGTGGAGGAACAAGT
GTTTCATATGGCCTGATGTGTCCTGCAGATGAGACAAGAACAATTATTTCTTTGGACACT
TCACAAATGAATCGAATTCTCTGGGTTGATGAGAACAATTTGACAGCTCATGTAGAGGCT
GGCATAACAGGACAAGAGTTGGAAAGACAGCTTAAAGAAAGTGGTTATTGTACAGGTCAT
GAACCAGATTCCCTGGAGTTCAGTACTGTAGGAGGATGGGTATCTACTCGCGCATCAGGC
ATGAAGAAGAATATCTATGGCAATATCGAGGACCTGGTGGTTCATATAAAAATGGTAACA
CCTAGAGGTATAATAGAAAAAAGCTGTCAAGGACCTCGTATGTCAACAGGCCCTGATATC
CATCACTTCATCATGGGATCTGAAGGAACTCTTGGTGTAATAACAGAAGCTACAATAAAA
ATCAGACCAGTCCCTGAATACCAAAAGTATGGCTCAGTAGCTTTCCCTAATTTTGAACAA
GGAGTAGCCTGTTTAAGAGAAATTGCAAAACAGAGATGTGCTCCGGCATCTATTCGCCTC
ATGGACAACAAGCAGTTTCAGTTTGGTCATGCTCTTAAACCTCAGGTTTCCTCTATTTTT
ACATCATTTTTGGACGGATTAAAAAAGTTTTATATTACAAAGTTTAAAGGATTTGACCCA
AATCAGCTAAGTGTAGCCACATTACTGTTTGAGGGGGATCGTGAGAAGGTTCTTCAACAT
GAAAAACAAGTGTATGATATTGCTGCAAAATTTGGTGGGTTGGCAGCTGGAGAAGATAAT
GGACAGAGAGGTTATTTGCTGACCTATGTTATTGCATACATTCGAGACTTGGCTTTGGAA
TACTATGTATTAGGAGAATCTTTTGAGACTTCTGCTCCTTGGGACAGGGTGGTAGATCTC
TGTAGAAATGTAAAAGAAAGAATAACAAGGGAATGCAAAGAGAAGGGTGTTCAGTTTGCT
CCTTTTTCTACATGCAGGGTGACGCAGACTTACGATGCAGGTGCTTGTATCTACTTCTAT
TTTGCCTTTAACTACAGGGGAATTAGTGACCCACTGACCGTATTTGAACAAACTGAGGCA
GCTGCTAGAGAAGAAATCCTTGCTAATGGAGGGAGCCTGTCACATCACCATGGAGTGGGC
AAGTTACGGAAGCAATGGCTAAAGGAAAGTATCTCTGATGTCGGCTTTGGGATGCTGAAG
TCTGTCAAGGAATATGTGGACCCCAATAACATCTTTGGAAACAGAAACCTTTTATAA
Protein Properties
Number of Residues 658
Molecular Weight 72911.2
Theoretical pI 7.37
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Alkyldihydroxyacetonephosphate synthase, peroxisomal
MAEAAAAAGGTGLGAGASYGSAADRDRDPDPDRAGRRLRVLSGHLLGRPREALSTNECKA
RRAASAATAAPTATPAAQESGTIPKKRQEVMKWNGWGYNDSKFIFNKKGQIELTGKRYPL
SGMGLPTFKEWIQNTLGVNVEHKTTSKASLNPSDTPPSVVNEDFLHDLKETNISYSQEAD
DRVFRAHGHCLHEIFLLREGMFERIPDIVLWPTCHDDVVKIVNLACKYNLCIIPIGGGTS
VSYGLMCPADETRTIISLDTSQMNRILWVDENNLTAHVEAGITGQELERQLKESGYCTGH
EPDSLEFSTVGGWVSTRASGMKKNIYGNIEDLVVHIKMVTPRGIIEKSCQGPRMSTGPDI
HHFIMGSEGTLGVITEATIKIRPVPEYQKYGSVAFPNFEQGVACLREIAKQRCAPASIRL
MDNKQFQFGHALKPQVSSIFTSFLDGLKKFYITKFKGFDPNQLSVATLLFEGDREKVLQH
EKQVYDIAAKFGGLAAGEDNGQRGYLLTYVIAYIRDLALEYYVLGESFETSAPWDRVVDL
CRNVKERITRECKEKGVQFAPFSTCRVTQTYDAGACIYFYFAFNYRGISDPLTVFEQTEA
AAREEILANGGSLSHHHGVGKLRKQWLKESISDVGFGMLKSVKEYVDPNNIFGNRNLL
GenBank ID Protein 189054871
UniProtKB/Swiss-Prot ID O00116
UniProtKB/Swiss-Prot Entry Name ADAS_HUMAN
PDB IDs Not Available
GenBank Gene ID AK314259
GeneCard ID AGPS
GenAtlas ID AGPS
HGNC ID HGNC:327
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  4. de Vet EC, van den Broek BT, van den Bosch H: Nucleotide sequence of human alkyl-dihydroxyacetonephosphate synthase cDNA reveals the presence of a peroxisomal targeting signal 2. Biochim Biophys Acta. 1997 May 17;1346(1):25-9. [PubMed:9187299 ]
  5. de Vet EC, Ijlst L, Oostheim W, Wanders RJ, van den Bosch H: Alkyl-dihydroxyacetonephosphate synthase. Fate in peroxisome biogenesis disorders and identification of the point mutation underlying a single enzyme deficiency. J Biol Chem. 1998 Apr 24;273(17):10296-301. [PubMed:9553082 ]
  6. Thai TP, Rodemer C, Jauch A, Hunziker A, Moser A, Gorgas K, Just WW: Impaired membrane traffic in defective ether lipid biosynthesis. Hum Mol Genet. 2001 Jan 15;10(2):127-36. [PubMed:11152660 ]