Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01564
Secondary Accession Numbers
  • 6860
Name Cytochrome P450 4F8
Synonyms
  1. CYPIVF8
Gene Name CYP4F8
Protein Type Unknown
Biological Properties
General Function Secondary metabolites biosynthesis, transport and catabolism
Specific Function Hydroxylates arachidonic acid (20:4n-6) to (18R)-hydroxyarachidonate. Shows little activity against prostaglandin (PG) D2, PGE1, PGE2, PGF2alpha, and leukotriene B4. Catalyzes omega-2 and omega-3-hydroxylation of PGH1 and PGH2. Catalyzes epoxidation of 4,7,10,13,16,19-(Z)-docosahexaenoic acid (22:6n-3) and 7,10,13,16,19-(Z)-docosapentaenoic acid (22:5n-3) and omega-3-hydroxylation of 4,7,10,13,16-(Z)-docosapentaenoic acid (22:5n-6). Catalyzes hydroxylation of PGI2 and carbaprostacyclin.
Pathways
  • Acetaminophen Action Pathway
  • Acetylsalicylic Acid Action Pathway
  • Antipyrine Action Pathway
  • Antrafenine Action Pathway
  • Arachidonic acid metabolism
  • Arachidonic Acid Metabolism
  • Bromfenac Action Pathway
  • Carprofen Action Pathway
  • Celecoxib Action Pathway
  • Diclofenac Action Pathway
  • Diflunisal Action Pathway
  • Etodolac Action Pathway
  • Etoricoxib Action Pathway
  • Fenoprofen Action Pathway
  • Flurbiprofen Action Pathway
  • Ibuprofen Action Pathway
  • Indomethacin Action Pathway
  • Ketoprofen Action Pathway
  • Ketorolac Action Pathway
  • Leukotriene C4 Synthesis Deficiency
  • Lornoxicam Action Pathway
  • Lumiracoxib Action Pathway
  • Magnesium salicylate Action Pathway
  • Mefenamic Acid Action Pathway
  • Meloxicam Action Pathway
  • Nabumetone Action Pathway
  • Naproxen Action Pathway
  • Nepafenac Action Pathway
  • Oxaprozin Action Pathway
  • Phenylbutazone Action Pathway
  • Piroxicam Action Pathway
  • Rofecoxib Action Pathway
  • Salicylate-sodium Action Pathway
  • Salicylic Acid Action Pathway
  • Salsalate Action Pathway
  • Sulindac Action Pathway
  • Suprofen Action Pathway
  • Tenoxicam Action Pathway
  • Tiaprofenic Acid Action Pathway
  • Tolmetin Action Pathway
  • Trisalicylate-choline Action Pathway
  • Valdecoxib Action Pathway
Reactions
RH + reduced flavoprotein + Oxygen → ROH + oxidized flavoprotein + Water details
Leukotriene B4 + NADPH + Hydrogen Ion + Oxygen → 20-Hydroxy-leukotriene B4 + NADP + Water details
Arachidonic acid + Oxygen + NADPH + Hydrogen Ion → 20-Hydroxyeicosatetraenoic acid + NADP + Water details
GO Classification
Biological Process
prostaglandin metabolic process
xenobiotic metabolic process
Cellular Component
endoplasmic reticulum membrane
integral to membrane
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
transition metal ion binding
electron carrier activity
iron ion binding
monooxygenase activity
heme binding
oxidoreductase activity
Molecular Function
electron carrier activity
aromatase activity
iron ion binding
heme binding
alkane 1-monooxygenase activity
Process
metabolic process
oxidation reduction
Cellular Location
  1. Endoplasmic reticulum membrane
  2. Single-pass membrane protein
  3. Microsome membrane
Gene Properties
Chromosome Location 19
Locus 19p13.1
SNPs CYP4F8
Gene Sequence
>1563 bp
ATGTCGCTGCTGAGCCTGTCTTGGCTGGGCCTCAGGCCGGTGGCAGCATCCCCGTGGCTG
CTCCTGCTGGTGGTCGGGGCCTCCTGGCTCCTGGCCCGCATCCTGGCCTGGACCTATGCC
TTCTATCACAACGGCCGCCGCCTCCGGTGTTTCCCGCAGCCCCGGAAACAGAACTGGTTC
TTGGGTCACCTGGGCCTGGTCACTCCCACAGAGGAGGGCTTGAGGGTCCTGACCCAGCTG
GTGGCCACCTACCCCCAGGGCTTTGTGAGGTGGTTGGGCCCCATCACTCCCATCATCAAC
TTGTGCCACCCTGACATCGTCCGATCTGTCATCAATACCTCAGATGCCATTACAGACAAG
GACATAGTCTTCTACAAGACCCTGAAGCCCTGGCTGGGGGATGGGCTCTTGTTAAGTGTT
GGTGACAAGTGGAGACACCACCGTCGCTTGCTGACGCCTGCCTTCCATTTCAACATCCTG
AAGCCCTATATAAAGATTTTCAGCAAGAGTGCAAACATCATGCATGCCAAGTGGCAACGC
CTGGCCATGGAGGGCAGCACCTGTCTGGATGTGTTTGAGCACATCAGCCTTATGACCCTG
GACAGTCTGCAGAAATGCATCTTCAGCTTTGACAGCAATTGTCAGGAGAAGCCCAGTGAA
TATATTACTGCGATCATGGAGCTCAGTGCCCTTGTAGTGAAACGGAATAACCAGTTCTTC
CGGTACAAGGACTTCCTGTACTTCCTCACTCCCTGTGGACGGCGCTTCCACAGGGCCTGC
AGACTGGTGCACGACTTCACAGATGCCGTCATCCAGGAGCGGCGCCGCACCCTCACTAGC
CAGGGTGTTGATGACTTCCTCCAAGCCAAGGCCAAGTCCAAGACTTTGGACTTTATTGAT
GTGCTCCTGCTGAGCGAGGATAAAAATGGTAAAGAGTTGTCAGATGAGGACATAAGAGCA
GAAGCTGACACTTTCATGTTTGGAGGCCATGACACCACGGCCAGTGGCCTCTCCTGGGTC
TTGTACAACCTCGCGAGGCACCCAGAATACCAAGAACGCTGCCGGCAGGAGGTGCAAGAG
CTTCTGAAGGACCGTGAGCCTAAAGAGATTGAATGGGACGACCTGGCCCAGTTGCCCTTC
CTGACCATGTGCCTGAAGGAGAGCCTGCGGTTGCATCCCCCAATCCCTACATTCGCCCGC
GGCTGCACCCAGGACGTGGTGCTCCCAGACAGCCGAGTCATCCCCAAAGGGAATGTCTGT
AACATCAACATCTTCGCAATCCATCACAACCCCTCAGTCTGGCCAGACCCTGAGGTCTAT
GACCCCTTCCGCTTCGACCCCGAAAACGCCCAGAAGAGGTCACCTATGGCTTTTATTCCT
TTCTCGGCGGGGCCCAGGAACTGCATCGGGCAGAAGTTCGCGATGGCAGAGATGAAGGTG
GTCCTGGCGCTCACGCTGCTGCGCTTCCGCATCCTGCCCGACCACAGGGAGCCACGCAGG
ACGCCGGAGATTGTTTTGCGTGCGGAGGACGGACTTTGGCTGCGAGTAGAACCCCTGGGC
TGA
Protein Properties
Number of Residues 520
Molecular Weight 59993.995
Theoretical pI 8.429
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Cytochrome P450 4F8
MSLLSLSWLGLRPVAASPWLLLLVVGASWLLARILAWTYAFYHNGRRLRCFPQPRKQNWF
LGHLGLVTPTEEGLRVLTQLVATYPQGFVRWLGPITPIINLCHPDIVRSVINTSDAITDK
DIVFYKTLKPWLGDGLLLSVGDKWRHHRRLLTPAFHFNILKPYIKIFSKSANIMHAKWQR
LAMEGSTCLDVFEHISLMTLDSLQKCIFSFDSNCQEKPSEYITAIMELSALVVKRNNQFF
RYKDFLYFLTPCGRRFHRACRLVHDFTDAVIQERRRTLTSQGVDDFLQAKAKSKTLDFID
VLLLSEDKNGKELSDEDIRAEADTFMFGGHDTTASGLSWVLYNLARHPEYQERCRQEVQE
LLKDREPKEIEWDDLAQLPFLTMCLKESLRLHPPIPTFARGCTQDVVLPDSRVIPKGNVC
NINIFAIHHNPSVWPDPEVYDPFRFDPENAQKRSPMAFIPFSAGPRNCIGQKFAMAEMKV
VLALTLLRFRILPDHREPRRTPEIVLRAEDGLWLRVEPLG
GenBank ID Protein 5733409
UniProtKB/Swiss-Prot ID P98187
UniProtKB/Swiss-Prot Entry Name CP4F8_HUMAN
PDB IDs Not Available
GenBank Gene ID AF133298
GeneCard ID CYP4F8
GenAtlas ID Not Available
HGNC ID HGNC:2648
References
General References
  1. Bylund J, Finnstrom N, Oliw EH: Gene expression of a novel cytochrome P450 of the CYP4F subfamily in human seminal vesicles. Biochem Biophys Res Commun. 1999 Jul 22;261(1):169-74. [PubMed:10405341 ]
  2. Bylund J, Hidestrand M, Ingelman-Sundberg M, Oliw EH: Identification of CYP4F8 in human seminal vesicles as a prominent 19-hydroxylase of prostaglandin endoperoxides. J Biol Chem. 2000 Jul 21;275(29):21844-9. [PubMed:10791960 ]
  3. Stark K, Torma H, Cristea M, Oliw EH: Expression of CYP4F8 (prostaglandin H 19-hydroxylase) in human epithelia and prominent induction in epidermis of psoriatic lesions. Arch Biochem Biophys. 2003 Jan 1;409(1):188-96. [PubMed:12464258 ]
  4. Stark K, Wongsud B, Burman R, Oliw EH: Oxygenation of polyunsaturated long chain fatty acids by recombinant CYP4F8 and CYP4F12 and catalytic importance of Tyr-125 and Gly-328 of CYP4F8. Arch Biochem Biophys. 2005 Sep 15;441(2):174-81. [PubMed:16112640 ]
  5. Stark K, Bylund J, Torma H, Sahlen G, Oliw EH: On the mechanism of biosynthesis of 19-hydroxyprostaglandins of human seminal fluid and expression of cyclooxygenase-2, PGH 19-hydroxylase (CYP4F8) and microsomal PGE synthase-1 in seminal vesicles and vas deferens. Prostaglandins Other Lipid Mediat. 2005 Jan;75(1-4):47-64. [PubMed:15789615 ]