You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01568
Secondary Accession Numbers
  • 6864
Name Beta,beta-carotene 15,15'-monooxygenase
Synonyms
  1. Beta-carotene dioxygenase 1
Gene Name BCMO1
Protein Type Unknown
Biological Properties
General Function Secondary metabolites biosynthesis, transport and catabolism
Specific Function Symmetrically cleaves beta-carotene into two molecules of retinal. The reaction proceeds in three stages, epoxidation of the 15,15'-double bond, hydration of the double bond leading to ring opening, and oxidative cleavage of the diol formed.
Pathways
  • Retinol metabolism
  • Retinol Metabolism
  • Vitamin A Deficiency
Reactions
beta-Carotene + Oxygen → Retinal details
beta-Carotene + Oxygen + Reduced acceptor → beta-Carotene-15,15'-epoxide + Water + Acceptor details
beta-Carotene-15,15'-epoxide + Water → 15,15'-Dihydroxy-beta-carotene details
15,15'-Dihydroxy-beta-carotene + Acceptor → Retinal + Reduced acceptor details
GO Classification
Biological Process
retinol metabolic process
vitamin A biosynthetic process
steroid metabolic process
retinal metabolic process
Cellular Component
cytosol
Molecular Function
metal ion binding
beta-carotene 15,15'-monooxygenase activity
monooxygenase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 16
Locus 16q23.2
SNPs BCMO1
Gene Sequence
>1644 bp
ATGGATATAATATTTGGCAGGAATAGGAAAGAACAGCTGGAGCCTGTGAGGGCCAAAGTG
ACAGGCAAGATTCCAGCATGGCTGCAGGGAACCCTGCTCCGCAACGGGCCTGGGATGCAC
ACAGTTGGGGAGTCCAGATACAACCATTGGTTCGACGGCCTTGCCCTGCTCCACAGCTTC
ACCATCAGAGACGGTGAAGTCTATTACAGGAGCAAATACCTGAGAAGCGATACCTACAAC
ACCAATATTGAGGCAAACAGGATTGTGGTGTCTGAGTTTGGAACAATGGCCTATCCGGAC
CCCTGCAAAAACATATTTTCCAAAGCTTTCTCCTACTTGTCTCACACCATCCCCGATTTC
ACCGACAACTGCCTGATCAACATCATGAAGTGCGGAGAAGACTTCTACGCGACCTCAGAG
ACCAATTACATCAGGAAAATCAACCCACAGACTCTGGAAACCCTGGAGAAGGTTGATTAT
CGTAAATACGTGGCGGTAAATCTGGCAACGTCACATCCCCATTATGATGAGGCTGGAAAT
GTTCTAAACATGGGCACATCCATTGTGGAAAAGGGGAAGACAAAGTATGTGATTTTTAAG
ATCCCTGCCACAGTACCAGAGGGCAAGAAGCAGGGGAAGAGCCCCTGGAAGCACACAGAG
GTGTTCTGCTCCATCCCATCCCGCTCCCTGCTCTCCCCAAGCTACTACCACAGCTTTGGA
GTCACCGAGAACTATGTCATCTTCCTTGAGCAGCCTTTCAGGTTGGATATTCTCAAGATG
GCAACCGCATACATCCGGAGAATGAGCTGGGCCTCCTGCCTGGCTTTCCACAGGGAGGAG
AAGACTTATATCCACATCATCGACCAAAGGACCAGGCAGCCTGTGCAGACCAAGTTTTAC
ACAGACGCCATGGTGGTCTTCCATCACGTCAACGCCTACGAAGAGGACGGCTGCATCGTG
TTTGACGTCATTGCCTACGAGGACAACAGCCTCTACCAGCTCTTCTACCTGGCCAACCTG
AACCAGGACTTCAAGGAGAACTCCAGGCTCACCTCGGTCCCCACCCTCAGGAGGTTTGCC
GTGCCCCTCCACGTGGACAAGAATGCAGAAGTGGGCACAAATTTAATCAAAGTGGCATCT
ACAACAGCCACGGCCCTGAAGGAAGAAGATGGCCAAGTCTACTGCCAGCCGGAATTTCTT
TATGAAGGCTTAGAGCTTCCACGGGTCAATTATGCTCACAATGGAAAGCAATACCGATAT
GTCTTTGCTACAGGAGTTCAGTGGAGTCCAATCCCAACCAAGATAATAAAATATGACATT
CTCACAAAGTCATCCTTAAAATGGAGAGAGGACGACTGCTGGCCAGCGGAACCCCTGTTT
GTGCCCGCGCCAGGTGCCAAGGATGAGGATGACGGAGTAATCTTATCAGCCATTGTCTCT
ACTGATCCCCAAAAGCTGCCTTTTCTGCTCATTCTGGATGCCAAAAGCTTTACGGAATTG
GCCCGTGCCTCTGTTGATGTCGATATGCACATGGATCTCCATGGATTATTCATTACAGAC
ATGGACTGGGACACAAAAAAGCAGGCCGCTTCTGAGGAACAGCGGGACAGGGCTTCCGAC
TGCCACGGGGCTCCTCTGACCTGA
Protein Properties
Number of Residues 547
Molecular Weight 62636.69
Theoretical pI 6.672
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Beta,beta-carotene 15,15'-monooxygenase
MDIIFGRNRKEQLEPVRAKVTGKIPAWLQGTLLRNGPGMHTVGESRYNHWFDGLALLHSF
TIRDGEVYYRSKYLRSDTYNTNIEANRIVVSEFGTMAYPDPCKNIFSKAFSYLSHTIPDF
TDNCLINIMKCGEDFYATSETNYIRKINPQTLETLEKVDYRKYVAVNLATSHPHYDEAGN
VLNMGTSIVEKGKTKYVIFKIPATVPEGKKQGKSPWKHTEVFCSIPSRSLLSPSYYHSFG
VTENYVIFLEQPFRLDILKMATAYIRRMSWASCLAFHREEKTYIHIIDQRTRQPVQTKFY
TDAMVVFHHVNAYEEDGCIVFDVIAYEDNSLYQLFYLANLNQDFKENSRLTSVPTLRRFA
VPLHVDKNAEVGTNLIKVASTTATALKEEDGQVYCQPEFLYEGLELPRVNYAHNGKQYRY
VFATGVQWSPIPTKIIKYDILTKSSLKWREDDCWPAEPLFVPAPGAKDEDDGVILSAIVS
TDPQKLPFLLILDAKSFTELARASVDVDMHMDLHGLFITDMDWDTKKQAASEEQRDRASD
CHGAPLT
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9HAY6
UniProtKB/Swiss-Prot Entry Name BCDO1_HUMAN
PDB IDs Not Available
GenBank Gene ID AF294900
GeneCard ID BCMO1
GenAtlas ID BCMO1
HGNC ID HGNC:13815
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Yan W, Jang GF, Haeseleer F, Esumi N, Chang J, Kerrigan M, Campochiaro M, Campochiaro P, Palczewski K, Zack DJ: Cloning and characterization of a human beta,beta-carotene-15,15'-dioxygenase that is highly expressed in the retinal pigment epithelium. Genomics. 2001 Mar 1;72(2):193-202. [PubMed:11401432 ]
  4. Lindqvist A, Sharvill J, Sharvill DE, Andersson S: Loss-of-function mutation in carotenoid 15,15'-monooxygenase identified in a patient with hypercarotenemia and hypovitaminosis A. J Nutr. 2007 Nov;137(11):2346-50. [PubMed:17951468 ]