You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01571
Secondary Accession Numbers
  • 6867
Name Synaptojanin-2
Synonyms
  1. Synaptic inositol-1,4,5-trisphosphate 5-phosphatase 2
  2. Synaptic inositol 1,4,5-trisphosphate 5-phosphatase 2
Gene Name SYNJ2
Protein Type Enzyme
Biological Properties
General Function Involved in nucleotide binding
Specific Function Inositol 5-phosphatase which may be involved in distinct membrane trafficking and signal transduction pathways. May mediate the inhibitory effect of Rac1 on endocytosis.
Pathways
  • Inositol phosphate metabolism
  • Phosphatidylinositol signaling system
Reactions
1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + Water → 1-phosphatidyl-1D-myo-inositol 4-phosphate + Phosphate details
1-Phosphatidyl-D-myo-inositol 4,5-bisphosphate + Water → 1-Phosphatidyl-1D-myo-inositol 4-phosphate + Phosphate details
GO Classification
Biological Process
small molecule metabolic process
phosphatidylinositol biosynthetic process
phosphatidylinositol dephosphorylation
inositol phosphate dephosphorylation
phosphatidylinositol phosphorylation
brain development
intracellular distribution of mitochondria
Cellular Component
cytosol
perinuclear region of cytoplasm
axon terminus
ruffle membrane
cytoplasmic microtubule
extrinsic to mitochondrial outer membrane
Function
hydrolase activity, acting on ester bonds
binding
catalytic activity
hydrolase activity
phosphoric ester hydrolase activity
phosphatase activity
inositol or phosphatidylinositol phosphatase activity
nucleic acid binding
phosphatidylinositol bisphosphate phosphatase activity
phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity
rna binding
Molecular Function
inositol-polyphosphate 5-phosphatase activity
phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity
RNA binding
nucleotide binding
Process
phosphorus metabolic process
phosphate metabolic process
dephosphorylation
metabolic process
cellular metabolic process
Cellular Location
  1. Membrane
Gene Properties
Chromosome Location 6
Locus 6q25.3
SNPs SYNJ2
Gene Sequence
>4491 bp
ATGGCCCTGAGCAAAGGGCTGCGGCTGCTGGGGCGCCTGGGGGCCGAGGGGGACTGTAGC
GTGCTGCTGGAGGCGCGCGGCCGCGACGACTGCCTGCTGTTCGAGGCCGGCACGGTGGCC
ACGCTGGCTCCAGAAGAAAAGGAAGTCATTAAAGGACAGTATGGCAAGCTCACGGACGCG
TACGGCTGCCTGGGGGAGCTGAGGCTGAAATCTGGTGGCACGTCTCTGAGCTTCCTGGTG
TTGGTGACAGGCTGCACATCTGTGGGCAGAATTCCAGATGCTGAAATCTACAAAATCACT
GCCACTGACTTTTACCCTCTTCAGGAAGAGGCCAAGGAGGAGGAACGCCTCATAGCTTTG
AAGAAAATCCTCAGCTCGGGGGTGTTCTATTTCTCATGGCCAAACGATGGGTCTCGCTTT
GACCTGACTGTCCGCACGCAGAAGCAGGGGGATGACAGCTCTGAATGGGGGAACTCCTTC
TTCTGGAACCAGCTGTTGCACGTGCCCTTGAGGCAGCACCAGGTGAGCTGCTGTGACTGG
CTGCTGAAGATCATCTGCGGGGTGGTCACCATCCGCACCGTGTATGCCTCCCACAAGCAG
GCCAAGGCCTGCCTCGTCTCTCGCGTTAGCTGTGAGCGCACAGGCACTCGCTTCCACACC
CGTGGCGTGAACGACGACGGCCATGTGTCCAACTTCGTGGAGACAGAGCAGATGATTTAC
ATGGACGATGGAGTGTCATCTTTTGTCCAGATCAGAGGCTCCGTTCCGCTGTTCTGGGAA
CAGCCAGGGCTTCAGGTTGGCTCCCATCATCTGAGACTCCACAGAGGCCTGGAAGCCAAT
GCCCCTGCTTTCGACAGGCACATGGTGCTTCTGAAGGAGCAGTACGGGCAGCAGGTGGTC
GTGAACCTTCTGGGAAGCAGAGGCGGAGAGGAGGTGCTCAACAGAGCCTTCAAGAAGCTG
CTCTGGGCTTCTTGCCACGCGGGCGACACGCCTATGATCAATTTTGACTTCCATCAGTTT
GCCAAAGGTGGGAAGCTAGAGAAATTGGAGACCCTCTTGAGGCCACAGTTAAAGCTGCAC
TGGGAAGACTTCGATGTGTTCACAAAGGGGGAGAACGTCAGTCCACGTTTTCAGAAAGGC
ACTTTGCGGATGAACTGTCTTGACTGCCTGGACCGAACCAACACTGTGCAGAGCTTCATC
GCGCTCGAGGTCCTGCATCTGCAGCTCAAGACCCTGGGGCTGAGTTCAAAACCCATCGTT
GACCGCTTTGTGGAGTCCTTCAAAGCCATGTGGTCTCTGAATGGCCACAGCCTGAGCAAG
GTGTTCACAGGCAGCAGAGCCCTGGAAGGGAAGGCCAAGGTGGGGAAGCTGAAGGATGGA
GCCCGGTCCATGTCTCGAACCATCCAGTCCAACTTCTTCGACGGGGTGAAGCAGGAGGCC
ATCAAGCTGCTGCTGGTTGGGGACGTCTACGGCGAGGAGGTGGCAGACAAAGGGGGCATG
CTGCTGGACAGCACGGCGCTCCTGGTGACTCCCAGGATCCTGAAAGCTATGACTGAGCGT
CAGTCCGAATTCACAAATTTCAAGCGGATCCGGATTGCTATGGGGACCTGGAACGTGAAC
GGAGGAAAGCAGTTCCGGAGCAACGTGCTCAGGACGGCGGAGCTGACAGACTGGCTGCTC
GACTCGCCCCAGCTCTCGGGAGCTACCGACTCCCAGGATGACAGCAGCCCAGCTGACATA
TTTGCTGTGGGGTTTGAAGAGATGGTGGAATTGAGCGCAGGGAATATTGTCAATGCCAGT
ACTACCAACAAGAAGATGTGGGGTGAACAGCTTCAGAAAGCCATCTCACGCTCTCATAGA
TACATTCTGTTGACTTCGGCACAGCTGGTGGGCGTCTGTCTTTATATCTTTGTACGTCCA
TACCATGTCCCGTTCATCAGGGACGTAGCCATCGACACAGTGAAGACGGGCATGGGGGGC
AAGGCGGGGAACAAGGGCGCCGTCGGCATCCGCTTCCAGTTCCACAGCACCAGCTTCTGC
TTCATATGTAGTCACCTGACGGCCGGGCAGTCCCAGGTGAAGGAGCGGAATGAAGACTAC
AAGGAGATCACCCAGAAACTCTGCTTCCCAATGGGGAGAAATGTTTTTTCTCATGATTAT
GTATTTTGGTGTGGCGATTTCAACTACCGCATTGATCTTACTTATGAAGAAGTCTTCTAT
TTTGTTAAACGCCAAGACTGGAAGAAACTTCTGGAATTTGATCAACTACAGCTACAGAAA
TCAAGTGGAAAAATTTTTAAGGACTTTCACGAAGGAGCCATTAACTTTGGACCCACCTAC
AAGTATGACGTTGGCTCAGCCGCCTACGATACAAGCGACAAATGCCGCACCCCCGCCTGG
ACAGACAGGGTGCTGTGGTGGAGGAAGAAACATCCCTTTGATAAAACAGCTGGAGAACTC
AACCTTCTAGACAGTGATCTAGATGTTGACACCAAAGTCAGACACACCTGGTCTCCTGGT
GCCCTGCAGTATTATGGTCGTGCGGAGCTACAAGCGTCTGATCACAGACCTGTGCTGGCG
ATCGTGGAGGTGGAAGTTCAGGAAGTCGATGTGGGTGCTCGGGAGAGGGTTTTCCAGGAA
GTGTCCTCCTTCCAGGGCCCCCTGGATGCCACTGTTGTAGTAAACCTTCAATCACCGACC
TTAGAAGAGAAAAACGAGTTTCCAGAGGACCTGCGTACTGAGCTCATGCAGACCTTGGGG
AGTTATGGGACAATTGTTCTTGTCAGGATCAACCAAGGGCAGATGCTGGTAACTTTTGCA
GACAGTCACTCGGCTCTCAGTGTCCTGGACGTGGACGGTATGAAGGTGAAAGGCAGAGCA
GTGAAGATTAGACCGAAGACCAAGGACTGGCTGAAAGGTTTGCGAGAGGAGATCATTCGG
AAACGAGACAGCATGGCCCCCGTGTCTCCCACTGCCAACTCCTGTTTGCTGGAGGAAAAC
TTTGACTTCACAAGTTTGGACTATGAGTCAGAAGGGGATATTCTTGAAGACGATGAAGAC
TACTTGGTGGATGAATTCAATCAGCCTGGAGTCTCGGACAGTGAACTCGGGGGAGACGAC
CTCTCTGATGTCCCCGGCCCCACAGCACTGGCTCCTCCCAGCAAGTCACCTGCTCTCACC
AAAAAGAAGCAGCATCCAACGTACAAAGATGACGCGGACCTGGTGGAGCTCAAGCGGGAG
CTGGAAGCCGTCGGGGAGTTCCGCCACCGTTCTCCGAGCAGGTCTCTGTCGGTCCCCAAC
CGGCCTCGGCCACCTCAACCCCCGCAGAGACCCCCCCCTCCAACCGGTTTAATGGTGAAA
AAGTCGGCTTCAGATGCGTCCATCTCCTCCGGCACCCATGGACAGTATTCAATTTTGCAG
ACGGCAAGACTTCTACCAGGAGCACCTCAGCAACCTCCCAAGGCTCGGACTGGAATAAGT
AAACCTTATAATGTCAAGCAGATCAAAACCACCAATGCCCAGGAGGCAGAAGCAGCAATC
CGGTGTCTCCTGGAAGCCAGAGGAGGTGCCTCCGAAGAAGCCCTAAGTGCCGTGGCCCCA
AGGGACCTTGAAGCATCCTCTGAACCAGAGCCCACACCGGGGGCAGCCAAACCAGAGACC
CCACAGGCGCCCCCACTCCTTCCCCGTCGGCCCCCACCCAGAGTTCCTGCCATCAAGAAG
CCAACCTTGAGAAGGACAGGAAAGCCCCTGTCACCGGAAGAACAGTTTGAGCAACAGACT
GTCCATTTTACAATCGGGCCCCCGGAGACAAGCGTTGAGGCCCCTCCTGTCGTGACAGCC
CCTCGAGTCCCTCCTGTTCCCAAACCAAGAACATTTCAGCCTGGGAAAGCTGCAGAGAGG
CCAAGCCACAGGAAGCCAGCATCAGACGAAGCCCCTCCTGGGGCAGGAGCCTCTGTGCCA
CCACCTCTGGAGGCGCCGCCTCTTGTGCCCAAGGTACCCCCGAGGAGGAAGAAGTCAGCC
CCCGCAGCCTTCCACCTGCAGGTCCTGCAGAGCAACAGCCAGCTTCTCCAGGGCCTCACT
TACAATAGCAGTGACAGCCCCTCTGGGCACCCACCTGCCGCGGGCACCGTCTTCCCACAA
GGGGACTTTCTCAGCACTTCATCTGCTACAAGCCCCGACAGCGATGGCACCAAAGCGATG
AAGCCAGAGGCAGCCCCACTTCTTGGTGATTATCAGGACCCCTTCTGGAACCTTCTTCAC
CACCCTAAACTGTTGAATAACACTTGGCTTTCTAAGAGCTCAGACCCTTTGGACTCAGGA
ACCAGGAGCCCCAAAAGAGATCCCATAGACCCAGTGTCAGCTGGCGCTTCAGCTGCCAAG
GCAGAGCTGCCACCAGATCATGAACACAAAACCTTAGGTCACTGGGTGACAATCAGTGAC
CAAGAAAAGAGGACAGCACTGCAGGTGTTTGACCCACTGGCAAAAACATGA
Protein Properties
Number of Residues 1496
Molecular Weight 165536.575
Theoretical pI 7.341
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Synaptojanin-2
MALSKGLRLLGRLGAEGDCSVLLEARGRDDCLLFEAGTVATLAPEEKEVIKGQYGKLTDA
YGCLGELRLKSGGTSLSFLVLVTGCTSVGRIPDAEIYKITATDFYPLQEEAKEEERLIAL
KKILSSGVFYFSWPNDGSRFDLTVRTQKQGDDSSEWGNSFFWNQLLHVPLRQHQVSCCDW
LLKIICGVVTIRTVYASHKQAKACLVSRVSCERTGTRFHTRGVNDDGHVSNFVETEQMIY
MDDGVSSFVQIRGSVPLFWEQPGLQVGSHHLRLHRGLEANAPAFDRHMVLLKEQYGQQVV
VNLLGSRGGEEVLNRAFKKLLWASCHAGDTPMINFDFHQFAKGGKLEKLETLLRPQLKLH
WEDFDVFTKGENVSPRFQKGTLRMNCLDCLDRTNTVQSFIALEVLHLQLKTLGLSSKPIV
DRFVESFKAMWSLNGHSLSKVFTGSRALEGKAKVGKLKDGARSMSRTIQSNFFDGVKQEA
IKLLLVGDVYGEEVADKGGMLLDSTALLVTPRILKAMTERQSEFTNFKRIRIAMGTWNVN
GGKQFRSNVLRTAELTDWLLDSPQLSGATDSQDDSSPADIFAVGFEEMVELSAGNIVNAS
TTNKKMWGEQLQKAISRSHRYILLTSAQLVGVCLYIFVRPYHVPFIRDVAIDTVKTGMGG
KAGNKGAVGIRFQFHSTSFCFICSHLTAGQSQVKERNEDYKEITQKLCFPMGRNVFSHDY
VFWCGDFNYRIDLTYEEVFYFVKRQDWKKLLEFDQLQLQKSSGKIFKDFHEGAINFGPTY
KYDVGSAAYDTSDKCRTPAWTDRVLWWRKKHPFDKTAGELNLLDSDLDVDTKVRHTWSPG
ALQYYGRAELQASDHRPVLAIVEVEVQEVDVGARERVFQEVSSFQGPLDATVVVNLQSPT
LEEKNEFPEDLRTELMQTLGSYGTIVLVRINQGQMLVTFADSHSALSVLDVDGMKVKGRA
VKIRPKTKDWLKGLREEIIRKRDSMAPVSPTANSCLLEENFDFTSLDYESEGDILEDDED
YLVDEFNQPGVSDSELGGDDLSDVPGPTALAPPSKSPALTKKKQHPTYKDDADLVELKRE
LEAVGEFRHRSPSRSLSVPNRPRPPQPPQRPPPPTGLMVKKSASDASISSGTHGQYSILQ
TARLLPGAPQQPPKARTGISKPYNVKQIKTTNAQEAEAAIRCLLEARGGASEEALSAVAP
RDLEASSEPEPTPGAAKPETPQAPPLLPRRPPPRVPAIKKPTLRRTGKPLSPEEQFEQQT
VHFTIGPPETSVEAPPVVTAPRVPPVPKPRTFQPGKAAERPSHRKPASDEAPPGAGASVP
PPLEAPPLVPKVPPRRKKSAPAAFHLQVLQSNSQLLQGLTYNSSDSPSGHPPAAGTVFPQ
GDFLSTSSATSPDSDGTKAMKPEAAPLLGDYQDPFWNLLHHPKLLNNTWLSKSSDPLDSG
TRSPKRDPIDPVSAGASAAKAELPPDHEHKTLGHWVTISDQEKRTALQVFDPLAKT
GenBank ID Protein 26190608
UniProtKB/Swiss-Prot ID O15056
UniProtKB/Swiss-Prot Entry Name SYNJ2_HUMAN
PDB IDs
GenBank Gene ID NM_003898.3
GeneCard ID SYNJ2
GenAtlas ID SYNJ2
HGNC ID HGNC:11504
References
General References
  1. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  4. Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ: Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer. Cell. 2007 Dec 14;131(6):1190-203. [PubMed:18083107 ]
  5. Nagase T, Ishikawa K, Nakajima D, Ohira M, Seki N, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro. DNA Res. 1997 Apr 28;4(2):141-50. [PubMed:9205841 ]
  6. Malecz N, McCabe PC, Spaargaren C, Qiu R, Chuang Y, Symons M: Synaptojanin 2, a novel Rac1 effector that regulates clathrin-mediated endocytosis. Curr Biol. 2000 Nov 2;10(21):1383-6. [PubMed:11084340 ]
  7. Nemoto Y, Wenk MR, Watanabe M, Daniell L, Murakami T, Ringstad N, Yamada H, Takei K, De Camilli P: Identification and characterization of a synaptojanin 2 splice isoform predominantly expressed in nerve terminals. J Biol Chem. 2001 Nov 2;276(44):41133-42. Epub 2001 Aug 9. [PubMed:11498538 ]