Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01573
Secondary Accession Numbers
  • 6869
Name Synaptojanin-1
Synonyms
  1. Synaptic inositol-1,4,5-trisphosphate 5-phosphatase 1
  2. Synaptic inositol 1,4,5-trisphosphate 5-phosphatase 1
Gene Name SYNJ1
Protein Type Enzyme
Biological Properties
General Function Cell cycle control, cell division, chromosome partitioning
Specific Function Inositol 5-phosphatase which has a role in clathrin-mediated endocytosis.
Pathways
  • Inositol phosphate metabolism
  • Joubert syndrome
  • Phosphatidylinositol Phosphate Metabolism
  • Phosphatidylinositol signaling system
Reactions
1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + Water → 1-phosphatidyl-1D-myo-inositol 4-phosphate + Phosphate details
1-Phosphatidyl-D-myo-inositol 4,5-bisphosphate + Water → 1-Phosphatidyl-1D-myo-inositol 4-phosphate + Phosphate details
GO Classification
Biological Process
small molecule metabolic process
phosphatidylinositol biosynthetic process
response to retinoic acid
phosphatidylinositol dephosphorylation
positive regulation of receptor-mediated endocytosis
inositol phosphate dephosphorylation
phosphatidylinositol phosphorylation
brain development
positive regulation of gliogenesis
synaptic vesicle endocytosis
learning
synaptic vesicle priming
synaptic vesicle uncoating
response to cytokine stimulus
Cellular Component
cytosol
membrane coat
Function
hydrolase activity, acting on ester bonds
binding
catalytic activity
hydrolase activity
phosphoric ester hydrolase activity
phosphatase activity
inositol or phosphatidylinositol phosphatase activity
nucleic acid binding
phosphatidylinositol bisphosphate phosphatase activity
phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity
rna binding
Molecular Function
inositol-polyphosphate 5-phosphatase activity
phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity
RNA binding
nucleotide binding
Process
phosphorus metabolic process
phosphate metabolic process
dephosphorylation
metabolic process
cellular metabolic process
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location 21
Locus 21q22.2
SNPs SYNJ1
Gene Sequence
>4839 bp
ATGCGGAAGAGATGGGCCTGCTGGAGCGGAAGTGACGCTCCCGGCGGCTGTGGCGGCGGC
TGCGGGAGAAGGAGGAGGAGGAGCCGGAGGAAGAGGGCTGCCTCCGAAGAAAGGAGAATG
GCGTTCAGTAAAGGATTCCGGATCTATCACAAATTGGATCCCCCACCTTTCAGCCTCATA
GTGGAAACTAGGCATAAGGAAGAATGTCTCATGTTCGAGTCTGGGGCTGTCGCTGTGCTC
TCATCTGCAGAAAAAGAGGCAATCAAGGGTACATACTCCAAAGTACTGGATGCATATGGA
CTCTTAGGTGTTCTGCGGTTAAATCTTGGTGATACTATGTTACATTATCTGGTCCTAGTC
ACTGGATGTATGTCTGTTGGAAAAATTCAAGAATCTGAAGTTTTCCGAGTTACTTCCACT
GAGTTTATATCACTGCGAATCGATTCTTCAGATGAGGATCGCATTTCAGAAGTGCGGAAA
GTTTTGAATTCAGGAAACTTTTATTTTGCATGGTCTGCATCTGGCATCAGTTTAGATTTG
AGTCTTAATGCGCATCGTAGCATGCAAGAACAGACAACTGATAATAGATTTTTCTGGAAT
CAGTCTTTGCATTTGCATCTCAAACACTATGGCGTGAATTGTGATGACTGGTTATTACGT
CTTATGTGTGGAGGAGTAGAAATCAGAACAATTTATGCTGCTCATAAACAGGCGAAGGCT
TGCCTCATTTCAAGATTAAGCTGTGAACGAGCTGGGACCAGGTTTAATGTCCGGGGAACA
AATGATGATGGTCATGTTGCCAATTTTGTAGAAACAGAACAGGTTGTGTACTTAGATGAC
TCAGTTTCTTCCTTCATACAAATCCGAGGATCTGTTCCATTGTTCTGGGAGCAACCAGGG
TTGCAAGTGGGATCTCATCGTGTCCGTATGTCAAGGGGATTTGAAGCCAATGCACCTGCT
TTTGACAGGCATTTTAGAACACTTAAGAACTTATATGGTAAACAAATAATAGTAAATTTG
CTTGGATCTAAGGAAGGTGAACATATGCTAAGTAAAGCTTTCCAGAGTCATTTGAAAGCT
TCTGAACATGCTGCTGATATCCAGATGGTGAATTTTGACTATCATCAAATGGTTAAGGGA
GGAAAGGCAGAAAAATTACATAGTGTTCTTAAACCTCAAGTCCAGAAGTTTCTAGATTAT
GGATTTTTTTATTTCAATGGAAGTGAAGTTCAAAGATGCCAGAGTGGTACAGTTCGAACA
AACTGCTTGGATTGTCTTGATAGAACAAATAGTGTGCAGGCATTTCTTGGCTTAGAGATG
CTAGCTAAACAGTTGGAAGCTCTTGGTTTAGCTGAAAAGCCTCAGTTGGTGACTCGCTTT
CAAGAAGTTTTTCGGTCAATGTGGTCCGTGAATGGTGATTCAATCAGTAAGATATATGCA
GGAACTGGAGCTCTTGAAGGGAAAGCGAAGTTAAAAGATGGTGCTCGCTCTGTTACCCGA
ACAATTCAGAATAACTTCTTTGACAGCTCCAAGCAAGAGGCCATTGATGTTTTGCTACTG
GGAAATACTCTGAATAGTGATTTAGCTGACAAAGCTCGAGCACTTTTAACTACTGGAAGT
TTGCGTGTTTCTGAGCAGACATTACAGTCAGCATCTTCTAAAGTACTAAAGAGCATGTGT
GAGAATTTCTACAAATATTCAAAGCCTAAGAAAATTCGAGTATGTGTCGGAACCTGGAAT
GTGAATGGTGGGAAGCAATTTCGCAGCATAGCTTTTAAGAATCAGACACTCACTGACTGG
CTTCTTGATGCACCCAAGTTAGCTGGCATCCAGGAGTTTCAAGATAAAAGAAGTAAGCCA
ACTGATATATTTGCAATTGGTTTTGAAGAAATGGTAGAATTGAATGCTGGAAACATTGTG
AGTGCAAGCACAACAAATCAGAAGCTCTGGGCTGTAGAACTTCAGAAGACAATCTCCAGA
GACAACAAGTATGTGCTGCTGGCTTCTGAACAGTTGGTGGGCGTCTGTTTGTTTGTTTTT
ATCAGACCACAGCATGCTCCTTTTATCAGGGATGTTGCAGTTGATACTGTGAAGACTGGA
ATGGGAGGTGCAACTGGAAATAAGGGAGCAGTTGCAATCCGAATGCTCTTCCATACAACC
AGCCTTTGCTTCGTCTGTAGCCACTTTGCTGCAGGGCAGTCACAAGTCAAAGAAAGAAAT
GAAGATTTTATAGAAATAGCACGAAAATTGAGTTTTCCTATGGGAAGGATGCTATTTTCC
CATGACTATGTATTTTGGTGTGGTGATTTCAACTATCGAATCGATCTCCCTAACGAAGAA
GTTAAAGAGCTCATAAGACAGCAAAATTGGGATTCTCTTATAGCAGGAGATCAACTTATC
AATCAGAAAAATGCTGGACAGGTTTTTAGAGGATTTTTAGAAGGAAAGGTAACCTTTGCT
CCGACATATAAGTATGACTTGTTTTCTGACGACTATGACACCAGTGAAAAGTGCCGCACC
CCTGCCTGGACAGACCGTGTCCTTTGGAGAAGGAGGAAATGGCCTTTTGATAGATCAGCT
GAAGATCTAGATCTTCTAAATGCTAGTTTTCAAGATGAAAGCAAAATTCTGTACACGTGG
ACTCCAGGCACTTTGCTGCACTATGGAAGAGCTGAGCTGAAGACTTCTGACCACAGGCCT
GTCGTTGCCCTGATTGATATAGATATATTTGAAGTTGAAGCTGAAGAGAGGCAAAACATT
TATAAAGAAGTAATTGCAGTTCAGGGTCCACCAGATGGTACAGTATTGGTCTCAATCAAA
AGTTCTTTACCAGAAAATAATTTTTTTGATGATGCCTTGATTGATGAGCTTCTGCAGCAG
TTTGCAAGTTTTGGTGAAGTTATACTTATAAGATTTGTAGAAGATAAAATGTGGGTTACA
TTTTTGGAGGGAAGCTCTGCCTTGAATGTTCTGAGCCTAAATGGTAAAGAGTTATTGAAT
CGGACTATAACTATTGCTTTAAAAAGTCCAGACTGGATCAAAAATTTGGAAGAAGAAATG
AGTTTAGAGAAAATTAGCATTGCATTGCCATCATCAACAAGCTCTACCCTGCTTGGTGAA
GATGCAGAGGTTGCAGCAGATTTTGATATGGAAGGTGATGTTGATGACTATAGTGCTGAA
GTGGAGGAACTTCTTCCTCAGCATCTCCAGCCATCTTCAAGTTCCGGCCTTGGTACTTCC
CCCAGCTCTTCACCCCGAACTAGTCCCTGCCAGTCACCTACAATATCAGAGGGTCCTGTA
CCTTCCCTTCCCATCAGACCAAGCCGAGCACCGTCAAGAACTCCTGGGCCTCCCAGTGCA
CAGAGTTCTCCTATTGACGCGCAGCCAGCAACGCCGCTGCCGCAGAAAGACCCCGCCCAG
CCCTTGGAGCCCAAGCGGCCGCCGCCGCCCCGCCCGGTCGCCCCTCCCACACGCCCGGCT
CCCCCACAGAGACCTCCTCCGCCTTCAGGGGCTAGGAGTCCTGCACCCACTAGAAAGGAA
TTTGGAGGTATTGGAGCCCCTCCCAGTCCTGGGGTAGCTAGGAGAGAGATGGAAGCACCC
AAAAGCCCTGGAACAACAAGGAAAGATAATATAGGACGCAGTCAGCCTTCACCTCAAGCA
GGACTTGCAGGCCCAGGACCTGCTGGATACAGTACAGCCAGACCGACGATTCCTCCTCGT
GCTGGAGTTATCAGTGCCCCACAGAGCCACGCGCGGGCATCTGCTGGAAGACTGACTCCT
GAAAGCCAAAGCAAAACATCAGAAACGTCGAAAGGTTCAACTTTCCTTCCTGAACCACTG
AAGCCTCAGGCTGCTTTTCCTCCGCAGTCTTCTTTGCCCCCGCCTGCTCAAAGGTTGCAA
GAGCCTCTTGTCCCTGTGGCAGCACCTATGCCTCAGTCTGGCCCCCAGCCAAATTTGGAA
ACCCCACCACAACCACCACCTCGAAGCAGGTCATCCCATAGCTTGCCTTCAGAAGCTTCC
TCACAACCGCAAGTAAAAACAAATGGAATCTCTGATGGCAAAAGAGAATCACCATTAAAG
ATTGACCCATTTGAAGATCTGTCATTTAATCTGCTTGCTGTATCAAAGGCTCAGCTATCT
GTTCAAACGTCACCTGTTCCCACCCCAGACCCAAAGAGGTTGATTCAGTTGCCTTCTGCA
ACGCAAAGTAATGTTTTGAGTTCTGTAAGTTGCATGCCAACAATGCCTCCAATTCCAGCT
CGGAGTCAATCCCAGGAAAATATGCGAAGTTCTCCAAACCCATTTATTACTGGCTTGACC
AGGACAAATCCTTTCAGTGACAGGACTGCTGCTCCTGGAAACCCATTTAGAGCCAAGTCT
GAAGAATCAGAGGCAACTTCATGGTTCTCCAAAGAAGAGCCCGTTACTATCAGTCCTTTC
CCTTCTCTGCAGCCTCTTGGTCATAACAAAAGCAGGGCTTCATCTTCACTTGATGGCTTT
AAGGACAGTTTTGATCTACAGGGCCAGTCTACATTAAAAATTAGCAACCCGAAAGGATGG
GTAACCTTCGAGGAAGAAGAGGATTTTGGTGTGAAAGGGAAGTCAAAGTCAGCTTGTTCA
GACTTACTGGGTAATCAGCCAAGTTCATTTTCTGGCTCCAACCTGACATTGAATGATGAC
TGGAATAAAGGTACAAATGTCTCCTTCTGTGTGTTGCCGTCAAGAAGACCTCCTCCACCT
CCTGTCCCTCTGCTCCCGCCCGGCACCAGCCCTCCAGTAGATCCTTTCACGACCTTGGCC
TCTAAGGCTTCACCCACACTGGACTTTACAGAAAGATAA
Protein Properties
Number of Residues 1573
Molecular Weight 143252.18
Theoretical pI 7.323
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Synaptojanin-1
MAFSKGFRIYHKLDPPPFSLIVETRHKEECLMFESGAVAVLSSAEKEAIKGTYSKVLDAY
GLLGVLRLNLGDTMLHYLVLVTGCMSVGKIQESEVFRVTSTEFISLRIDSSDEDRISEVR
KVLNSGNFYFAWSASGISLDLSLNAHRSMQEQTTDNRFFWNQSLHLHLKHYGVNCDDWLL
RLMCGGVEIRTIYAAHKQAKACLISRLSCERAGTRFNVRGTNDDGHVANFVETEQVVYLD
DSVSSFIQIRGSVPLFWEQPGLQVGSHRVRMSRGFEANAPAFDRHFRTLKNLYGKQIIVN
LLGSKEGEHMLSKAFQSHLKASEHAADIQMVNFDYHQMVKGGKAEKLHSVLKPQVQKFLD
YGFFYFNGSEVQRCQSGTVRTNCLDCLDRTNSVQAFLGLEMLAKQLEALGLAEKPQLVTR
FQEVFRSMWSVNGDSISKIYAGTGALEGKAKLKDGARSVTRTIQNNFFDSSKQEAIDVLL
LGNTLNSDLADKARALLTTGSLRVSEQTLQSASSKVLKSMCENFYKYSKPKKIRVCVGTW
NVNGGKQFRSIAFKNQTLTDWLLDAPKLAGIQEFQDKRSKPTDIFAIGFEEMVELNAGNI
VSASTTNQKLWAVELQKTISRDNKYVLLASEQLVGVCLFVFIRPQHAPFIRDVAVDTVKT
GMGGATGNKGAVAIRMLFHTTSLCFVCSHFAAGQSQVKERNEDFIEIARKLSFPMGRMLF
SHDYVFWCGDFNYRIDLPNEEVKELIRQQNWDSLIAGDQLINQKNAGQVFRGFLEGKVTF
APTYKYDLFSDDYDTSEKCRTPAWTDRVLWRRRKWPFDRSAEDLDLLNASFQDESKILYT
WTPGTLLHYGRAELKTSDHRPVVALIDIDIFEVEAEERQNIYKEVIAVQGPPDGTVLVSI
KSSLPENNFFDDALIDELLQQFASFGEVILIRFVEDKMWVTFLEGSSALNVLSLNGKELL
NRTITIALKSPDWIKNLEEEMSLEKISIALPSSTSSTLLGEDAEVAADFDMEGDVDDYSA
EVEELLPQHLQPSSSSGLGTSPSSSPRTSPCQSPTISEGPVPSLPIRPSRAPSRTPGPPS
AQSSPIDAQPATPLPQKDPAQPLEPKRPPPPRPVAPPTRPAPPQRPPPPSGARSPAPTRK
EFGGIGAPPSPGVARREMEAPKSPGTTRKDNIGRSQPSPQAGLAGPGPAGYSTARPTIPP
RAGVISAPQSHARASAGRLTPESQSKTSETSKGSTFLPEPLKPQAAFPPQSSLPPPAQRL
QEPLVPVAAPMPQSGPQPNLETPPQPPPRSRSSHSLPSEASSQPQVKTNGISDGKRESPL
KIDPFEDLSFNLLAVSKAQLSVQTSPVPTPDPKRLIQLPSATQSNVLSSVSCMPTMPPIP
ARSQSQENMRSSPNPFITGLTRTNPFSDRTAAPGNPFRAKSEESEATSWFSKEEPVTISP
FPSLQPLGHNKSRASSSLDGFKDSFDLQGQSTLKISNPKGWVTFEEEEDFGVKGKSKSAC
SDLLGNQPSSFSGSNLTLNDDWNKGTNVSFCVLPSRRPPPPPVPLLPPGTSPPVDPFTTL
ASKASPTLDFTER
GenBank ID Protein 237757310
UniProtKB/Swiss-Prot ID O43426
UniProtKB/Swiss-Prot Entry Name SYNJ1_HUMAN
PDB IDs
GenBank Gene ID NM_003895
GeneCard ID SYNJ1
GenAtlas ID Not Available
HGNC ID HGNC:11503
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  4. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  5. Nakajima D, Okazaki N, Yamakawa H, Kikuno R, Ohara O, Nagase T: Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones. DNA Res. 2002 Jun 30;9(3):99-106. [PubMed:12168954 ]
  6. Hattori M, Fujiyama A, Taylor TD, Watanabe H, Yada T, Park HS, Toyoda A, Ishii K, Totoki Y, Choi DK, Groner Y, Soeda E, Ohki M, Takagi T, Sakaki Y, Taudien S, Blechschmidt K, Polley A, Menzel U, Delabar J, Kumpf K, Lehmann R, Patterson D, Reichwald K, Rump A, Schillhabel M, Schudy A, Zimmermann W, Rosenthal A, Kudoh J, Schibuya K, Kawasaki K, Asakawa S, Shintani A, Sasaki T, Nagamine K, Mitsuyama S, Antonarakis SE, Minoshima S, Shimizu N, Nordsiek G, Hornischer K, Brant P, Scharfe M, Schon O, Desario A, Reichelt J, Kauer G, Blocker H, Ramser J, Beck A, Klages S, Hennig S, Riesselmann L, Dagand E, Haaf T, Wehrmeyer S, Borzym K, Gardiner K, Nizetic D, Francis F, Lehrach H, Reinhardt R, Yaspo ML: The DNA sequence of human chromosome 21. Nature. 2000 May 18;405(6784):311-9. [PubMed:10830953 ]
  7. Nagase T, Ishikawa K, Suyama M, Kikuno R, Hirosawa M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1998 Dec 31;5(6):355-64. [PubMed:10048485 ]
  8. Haffner C, Takei K, Chen H, Ringstad N, Hudson A, Butler MH, Salcini AE, Di Fiore PP, De Camilli P: Synaptojanin 1: localization on coated endocytic intermediates in nerve terminals and interaction of its 170 kDa isoform with Eps15. FEBS Lett. 1997 Dec 15;419(2-3):175-80. [PubMed:9428629 ]
  9. Cestra G, Castagnoli L, Dente L, Minenkova O, Petrelli A, Migone N, Hoffmuller U, Schneider-Mergener J, Cesareni G: The SH3 domains of endophilin and amphiphysin bind to the proline-rich region of synaptojanin 1 at distinct sites that display an unconventional binding specificity. J Biol Chem. 1999 Nov 5;274(45):32001-7. [PubMed:10542231 ]