You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01580
Secondary Accession Numbers
  • 6876
Name Glycylpeptide N-tetradecanoyltransferase 2
Synonyms
  1. Myristoyl-CoA:protein N-myristoyltransferase 2
  2. NMT 2
  3. Peptide N-myristoyltransferase 2
  4. Type II N-myristoyltransferase
Gene Name NMT2
Protein Type Enzyme
Biological Properties
General Function Involved in glycylpeptide N-tetradecanoyltransferase activity
Specific Function Adds a myristoyl group to the N-terminal glycine residue of certain cellular and viral proteins.
Pathways Not Available
Reactions
Tetradecanoyl-CoA + glycylpeptide → Coenzyme A + N-tetradecanoylglycylpeptide details
GO Classification
Biological Process
protein lipoylation
N-terminal protein myristoylation
egress of virus within host cell
Cellular Component
cytosol
plasma membrane
Golgi apparatus
Function
catalytic activity
transferase activity
transferase activity, transferring acyl groups
transferase activity, transferring acyl groups other than amino-acyl groups
acyltransferase activity
n-acyltransferase activity
glycylpeptide n-tetradecanoyltransferase activity
Molecular Function
glycylpeptide N-tetradecanoyltransferase activity
catalytic activity
Process
metabolic process
macromolecule metabolic process
protein amino acid lipidation
macromolecule modification
protein modification process
n-terminal protein lipidation
n-terminal protein myristoylation
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location 10
Locus 10p13
SNPs NMT2
Gene Sequence
>1497 bp
ATGGCGGAGGACAGCGAGTCTGCGGCCAGCCAGCAGAGCCTGGAACTGGACGACCAGGAC
ACGTGCGGGATAGACGGGGACAATGAGGAGGAGACGGAGCACGCCAAAGGAAGTCCTGGA
GGGTATTTGGGAGCCAAAAAGAAAAAGAAGAAACAGAAGAGAAAAAAGGAGAAACCAAAT
TCCGGAGGCACCAAGTCAGACTCGGCATCTGATTCCCAGGAGATTAAAATTCAGCAGCCT
TCGAAAAATCCCAGTGTTCCAATGCAGAAGTTGCAGGATATCCAGAGAGCAATGGAGCTG
CTATCCGCATGCCAGGGCCCAGCCAGGAACATTGATGAGGCTGCAAAGCACAGATACCAG
TTTTGGGACACACAACCGGTACCAAAACTAGATGAAGTCATAACATCTCATGGTGCAATT
GAACCAGATAAAGACAACGTACGCCAAGAACCGTATTCTTTGCCACAGGGTTTTATGTGG
GACACTTTAGACTTGAGTGATGCCGAAGTGCTCAAGGAGTTATACACGTTGTTAAATGAG
AATTACGTAGAAGATGATGACAATATGTTCCGATTTGACTATTCACCCGAGTTCCTGTTG
TGGGCTCTGCGTCCACCAGGCTGGCTCCTGCAGTGGCACTGTGGGGTCAGAGTGTCTTCA
AATAAAAAACTGGTCGGGTTCATAAGTGCCATCCCAGCAAACATTCGGATTTATGACAGT
GTGAAGAAGATGGTAGAAATCAACTTTCTTTGTGTTCATAAGAAGTTGAGATCGAAACGG
GTAGCCCCAGTGCTAATCCGAGAGATCACTAGAAGAGTGAACCTGGAAGGGATCTTCCAG
GCTGTGTACACCGCGGGAGTGGTTCTTCCTAAGCCCATAGCCACATGCAGATACTGGCAT
CGATCACTAAACCCCAGAAAATTGGTAGAAGTGAAATTTTCTCACTTGAGTAGAAATATG
ACTTTACAGAGAACAATGAAGCTATACAGACTTCCAGATGTTACAAAGACTTCAGGTTTG
AGACCAATGGAACCAAAAGATATCAAATCAGTTCGAGAATTAATCAACACTTACCTGAAG
CAGTTTCATCTGGCTCCAGTGATGGATGAAGAGGAAGTAGCCCACTGGTTCCTCCCCCGG
GAGCACATTATTGACACGTTTGTAGTGGAGAGCCCCAACGGTAAACTGACTGATTTCCTG
AGCTTCTATACGCTCCCCTCCACGGTGATGCACCACCCTGCTCACAAGAGCCTCAAAGCC
GCCTACTCATTCTACAACATCCACACAGAGACGCCCCTGCTGGACCTCATGAGCGACGCG
CTCATCCTGGCTAAATCGAAAGGATTTGATGTATTCAATGCACTGGATTTGATGGAAAAT
AAGACATTCTTGGAAAAACTCAAGTTTGGTATAGGAGATGGCAATTTGCAGTATTACCTG
TACAATTGGAGGTGTCCAGGTACAGATTCTGAAAAGGTTGGACTAGTACTACAATAG
Protein Properties
Number of Residues 498
Molecular Weight 56979.755
Theoretical pI 7.574
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Glycylpeptide N-tetradecanoyltransferase 2
MAEDSESAASQQSLELDDQDTCGIDGDNEEETEHAKGSPGGYLGAKKKKKKQKRKKEKPN
SGGTKSDSASDSQEIKIQQPSKNPSVPMQKLQDIQRAMELLSACQGPARNIDEAAKHRYQ
FWDTQPVPKLDEVITSHGAIEPDKDNVRQEPYSLPQGFMWDTLDLSDAEVLKELYTLLNE
NYVEDDDNMFRFDYSPEFLLWALRPPGWLLQWHCGVRVSSNKKLVGFISAIPANIRIYDS
VKKMVEINFLCVHKKLRSKRVAPVLIREITRRVNLEGIFQAVYTAGVVLPKPIATCRYWH
RSLNPRKLVEVKFSHLSRNMTLQRTMKLYRLPDVTKTSGLRPMEPKDIKSVRELINTYLK
QFHLAPVMDEEEVAHWFLPREHIIDTFVVESPNGKLTDFLSFYTLPSTVMHHPAHKSLKA
AYSFYNIHTETPLLDLMSDALILAKSKGFDVFNALDLMENKTFLEKLKFGIGDGNLQYYL
YNWRCPGTDSEKVGLVLQ
GenBank ID Protein 3005065
UniProtKB/Swiss-Prot ID O60551
UniProtKB/Swiss-Prot Entry Name NMT2_HUMAN
PDB IDs Not Available
GenBank Gene ID AF043325
GeneCard ID NMT2
GenAtlas ID NMT2
HGNC ID HGNC:7858
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  3. Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR, Rogers J: The DNA sequence and comparative analysis of human chromosome 10. Nature. 2004 May 27;429(6990):375-81. [PubMed:15164054 ]
  4. Giang DK, Cravatt BF: A second mammalian N-myristoyltransferase. J Biol Chem. 1998 Mar 20;273(12):6595-8. [PubMed:9506952 ]