Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01588
Secondary Accession Numbers
  • 6884
Name Phosphoacetylglucosamine mutase
Synonyms
  1. Acetylglucosamine phosphomutase
  2. N-acetylglucosamine-phosphate mutase
  3. PAGM
  4. PGM 3
  5. Phosphoglucomutase-3
Gene Name PGM3
Protein Type Unknown
Biological Properties
General Function Involved in intramolecular transferase activity, phosphotransferases
Specific Function Interconverts GlcNAc-6-P and GlcNAc-1-P.
Pathways
  • Amino sugar and nucleotide sugar metabolism
  • Amino Sugar Metabolism
  • G(M2)-Gangliosidosis: Variant B, Tay-sachs disease
  • Salla Disease/Infantile Sialic Acid Storage Disease
  • Sialuria or French Type Sialuria
  • Tay-Sachs Disease
  • UDP-N-acetyl-alpha-D-glucosamine biosynthesis
Reactions
N-Acetyl-glucosamine 1-phosphate → N-Acetyl-D-Glucosamine 6-Phosphate details
N-Acetyl-D-Glucosamine 6-Phosphate → N-Acetyl-glucosamine 1-phosphate details
GO Classification
Biological Process
dolichol-linked oligosaccharide biosynthetic process
post-translational protein modification
protein N-linked glycosylation via asparagine
glucosamine metabolic process
hemopoiesis
UDP-N-acetylglucosamine biosynthetic process
Cellular Component
cytosol
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
magnesium ion binding
isomerase activity
phosphoacetylglucosamine mutase activity
intramolecular transferase activity
intramolecular transferase activity, phosphotransferases
Molecular Function
magnesium ion binding
phosphoacetylglucosamine mutase activity
Process
metabolic process
primary metabolic process
carbohydrate metabolic process
Cellular Location Not Available
Gene Properties
Chromosome Location 6
Locus 6q14.1-q15
SNPs PGM3
Gene Sequence
>1629 bp
ATGGATTTAGGTGCTATTACAAAATACTCAGCATTACACGCCAAGCCCAATGGACTGATC
CTTCAATACGGGACTGCTGGATTTCGAACGAAGGCAGAACATCTTGATCATGTCATGTTT
CGCATGGGATTATTAGCTGTCCTGAGGTCAAAACAGACAAAATCCACTATAGGAGTCATG
GTAACAGCGTCCCACAATCCTGAGGAAGACAATGGTGTAAAATTGGTTGATCCTTTGGGT
GAAATGTTGGCACCATCCTGGGAGGAACATGCCACCTGTTTAGCAAATGCTGAGGAACAA
GATATGCAGAGAGTGCTTATTGACATCAGCGAGAAAGAAGCTGTGAATCTGCAACAAGAT
GCCTTTGTAGTTATTGGTAGAGATACCAGGCCCAGCAGTGAGAAACTTTCACAATCTGTA
ATAGATGGTGTGACTGTTCTAGGAGGTCAATTCCATGATTATGGCTTGTTAACAACACCC
CAGCTGCACTACATGGTGTATTGTCGAAACACGGGTGGCCGATATGGAAAGGCAACTATA
GAAGGTTACTACCAGAAACTCTCTAAGGCTTTTGTGGAACTCACCAAACAGGCTTCTTGC
AGTGGAGATGAATACAGATCACTTAAGGTTGACTGTGCAAATGGCATAGGGGCCCTGAAG
CTAAGGGAAATGGAACACTACTTCTCACAGGGCCTGTCAGTTCAGCTGTTTAATGATGGG
TCCAAGGGCAAACTCAATCATTTATGTGGAGCTGACTTTGTGAAAAGTCATCAGAAACCT
CCACAGGGAATGGAAATTAAGTCCAATGAAAGATGCTGTTCTTTTGATGGAGATGCAGAC
AGAATTGTTTATTACTACCATGATGCAGATGGCCACTTTCATCTCATAGATGGAGACAAG
ATAGCAACGTTAATTAGCAGTTTCCTTAAAGAGCTCCTGGTGGAGATTGGAGAAAGTTTG
AATATTGGTGTTGTACAAACTGCATATGCAAATGGAAGTTCAACACGGTATCTTGAAGAA
GTTATGAAGGTACCTGTCTATTGCACTAAGACTGGTGTAAAACATTTGCACCACAAGGCT
CAAGAGTTTGACATTGGAGTTTATTTTGAAGCAAATGGGCATGGCACTGCACTGTTTAGT
ACAGCTGTTGAAATGAAGATAAAACAATCAGCAGAACAACTGGAAGATAAGAAAAGAAAA
GCTGCTAAGATGCTTGAAAACATTATTGACTTGTTTAACCAGGCAGCTGGTGATGCTATT
TCTGACATGCTGGTGATTGAAGCAATCTTGGCTCTGAAGGGCTTGACTGTACAACAGTGG
GATGCTCTCTATACAGATCTTCCAAACAGACAACTTAAAGTTCAGGTTGCAGACAGGAGA
GTTATTAGCACTACCGATGCTGAAAGACAAGCAGTTACACCCCCAGGATTACAGGAGGCA
ATCAATGACCTGGTGAAGAAGTACAAGCTTTCTCGAGCTTTTGTCCGGCCCTCTGGTACA
GAAGATGTCGTCCGAGTATATGCAGAAGCAGACTCACAAGAAAGTGCAGATCACCTTGCA
CATGAAGTGAGCTTGGCAGTATTTCAGCTGGCTGGAGGAATTGGAGAAAGGCCCCAACCA
GGTTTCTGA
Protein Properties
Number of Residues 542
Molecular Weight 62940.905
Theoretical pI 5.999
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Phosphoacetylglucosamine mutase
MDLGAITKYSALHAKPNGLILQYGTAGFRTKAEHLDHVMFRMGLLAVLRSKQTKSTIGVM
VTASHNPEEDNGVKLVDPLGEMLAPSWEEHATCLANAEEQDMQRVLIDISEKEAVNLQQD
AFVVIGRDTRPSSEKLSQSVIDGVTVLGGQFHDYGLLTTPQLHYMVYCRNTGGRYGKATI
EGYYQKLSKAFVELTKQASCSGDEYRSLKVDCANGIGALKLREMEHYFSQGLSVQLFNDG
SKGKLNHLCGADFVKSHQKPPQGMEIKSNERCCSFDGDADRIVYYYHDADGHFHLIDGDK
IATLISSFLKELLVEIGESLNIGVVQTAYANGSSTRYLEEVMKVPVYCTKTGVKHLHHKA
QEFDIGVYFEANGHGTALFSTAVEMKIKQSAEQLEDKKRKAAKMLENIIDLFNQAAGDAI
SDMLVIEAILALKGLTVQQWDALYTDLPNRQLKVQVADRRVISTTDAERQAVTPPGLQEA
INDLVKKYKLSRAFVRPSGTEDVVRVYAEADSQESADHLAHEVSLAVFQLAGGIGERPQP
GF
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID O95394
UniProtKB/Swiss-Prot Entry Name AGM1_HUMAN
PDB IDs Not Available
GenBank Gene ID AF102265
GeneCard ID PGM3
GenAtlas ID PGM3
HGNC ID HGNC:8907
References
General References
  1. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404 ]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  4. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  5. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  6. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  7. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  8. Li C, Rodriguez M, Banerjee D: Cloning and characterization of complementary DNA encoding human N-acetylglucosamine-phosphate mutase protein. Gene. 2000 Jan 25;242(1-2):97-103. [PubMed:10721701 ]
  9. Mio T, Yamada-Okabe T, Arisawa M, Yamada-Okabe H: Functional cloning and mutational analysis of the human cDNA for phosphoacetylglucosamine mutase: identification of the amino acid residues essential for the catalysis. Biochim Biophys Acta. 2000 Jul 24;1492(2-3):369-76. [PubMed:11004509 ]
  10. Pang H, Koda Y, Soejima M, Kimura H: Identification of human phosphoglucomutase 3 (PGM3) as N-acetylglucosamine-phosphate mutase (AGM1). Ann Hum Genet. 2002 Mar;66(Pt 2):139-44. [PubMed:12174217 ]