Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01589
Secondary Accession Numbers
  • 6885
Name Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1
Synonyms
  1. Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 67 kDa subunit
  2. RPN-I
  3. Ribophorin I
  4. Ribophorin-1
Gene Name RPN1
Protein Type Enzyme
Biological Properties
General Function Involved in dolichyl-diphosphooligosaccharide-protein glycotransferase activity
Specific Function Essential subunit of the N-oligosaccharyl transferase (OST) complex which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains.
Pathways
  • N-Glycan biosynthesis
  • protein glycosylation
  • Protein processing in endoplasmic reticulum
Reactions
Dolichyl diphosphooligosaccharide + [protein]-L-asparagine → Dolichyl diphosphate + a glycoprotein with the oligosaccharide chain attached by N-beta-D-glycosyl linkage to a protein L-asparagine details
GO Classification
Biological Process
translation
SRP-dependent cotranslational protein targeting to membrane
post-translational protein modification
protein N-linked glycosylation via asparagine
Cellular Component
melanosome
oligosaccharyltransferase complex
integral to membrane
rough endoplasmic reticulum
Component
cell part
membrane part
endoplasmic reticulum
intrinsic to membrane
organelle
membrane-bounded organelle
intracellular membrane-bounded organelle
integral to membrane
Function
catalytic activity
transferase activity
transferase activity, transferring hexosyl groups
transferase activity, transferring glycosyl groups
oligosaccharyl transferase activity
dolichyl-diphosphooligosaccharide-protein glycotransferase activity
Molecular Function
dolichyl-diphosphooligosaccharide-protein glycotransferase activity
Process
metabolic process
macromolecule metabolic process
macromolecule modification
protein modification process
protein amino acid glycosylation
Cellular Location
  1. Melanosome
  2. Endoplasmic reticulum membrane
  3. Single-pass type I membrane protein
Gene Properties
Chromosome Location 3
Locus 3q21.3
SNPs RPN1
Gene Sequence
>1824 bp
ATGGAGGCGCCAGCCGCCGGCTTGTTTCTGCTCCTGTTGCTTGGGACTTGGGCCCCGGCG
CCGGGCAGCGCCTCCTCCGAGGCACCGCCGCTGATCAATGAGGACGTGAAGCGCACAGTG
GACCTAAGCAGCCACCTGGCTAAGGTGACGGCCGAGGTGGTCCTGGCGCACCTGGGCGGC
GGCTCCACGTCCCGAGCTACCTCTTTCCTGCTGGCTTTGGAGCCTGAGCTCGAGGCCCGG
CTGGCGCACCTGGGCGTGCAGGTAAAGGGAGAAGATGAGGAAGAGAACAATTTGGAAGTA
CGTGAAACCAAAATTAAGGGTAAAAGTGGGAGATTCTTCACAGTCAAGCTCCCAGTTGCT
CTTGATCCTGGGGCCAAGATTTCAGTCATTGTGGAAACAGTCTACACCCATGTGCTTCAT
CCATATCCAACCCAGATCACCCAGTCAGAGAAACAGTTTGTGGTGTTTGAGGGGAACCAT
TATTTCTACTCTCCCTATCCAACGAAGACACAAACCATGCGTGTGAAGCTTGCCTCTCGA
AATGTGGAGAGCTACACCAAGCTGGGGAACCCCACGCGCTCTGAGGACCTACTGGATTAT
GGGCCTTTCAGAGATGTGCCTGCCTATAGTCAGGATACTTTTAAAGTACATTATGAGAAC
AACAGCCCTTTCCTGACCATCACCAGCATGACCCGAGTCATTGAAGTCTCTCACTGGGGT
AATATTGCTGTGGAAGAAAATGTGGACTTAAAGCACACAGGAGCTGTGCTTAAGGGGCCT
TTCTCACGCTATGATTACCAGAGACAGCCAGATAGTGGAATATCCTCCATCCGTTCTTTT
AAGACCATCCTTCCTGCTGCTGCCCAGGATGTTTATTACCGGGATGAGATTGGCAATGTT
TCTACCAGCCACCTCCTTATTTTGGATGACTCTGTAGAGATGGAAATCCGGCCTCGCTTC
CCTCTCTTTGGCGGGTGGAAGACCCATTACATCGTTGGCTACAACCTCCCAAGCTATGAG
TACCTCTATAATTTGGGTGACCAGTATGCACTGAAGATGAGGTTTGTGGACCATGTGTTT
GATGAACAAGTGATAGATTCTCTGACTGTGAAGATCATCCTGCCTGAAGGAGCCAAGAAC
ATTGAAATTGATAGTCCCTATGAAATCAGCCGTGCCCCAGATGAGCTGCACTACACCTAT
CTGGATACATTTGGCCGCCCTGTGATTGTTGCCTACAAGAAAAATCTGGTAGAACAGCAC
ATTCAGGACATTGTGGTCCACTACACGTTCAACAAGGTGCTCATGCTGCAGGAGCCCCTG
CTGGTGGTGGCGGCCTTCTACATCCTGTTCTTCACCGTTATCATCTATGTTCGGCTGGAC
TTCTCCATCACCAAGGATCCAGCCGCAGAAGCCAGGATGAAGGTAGCCTGCATCACAGAG
CAGGTCTTGACCCTGGTCAACAAGAGAATAGGCCTTTACCGTCACTTTGACGAGACCGTC
AATAGGTACAAGCAATCCCGGGACATCTCCACCCTCAACAGTGGCAAGAAGAGCCTGGAG
ACTGAACACAAGGCCTTGACCAGTGAGATTGCACTGCTGCAGTCCAGGCTGAAGACAGAG
GGCTCTGATCTGTGCGACAGAGTGAGCGAAATGCAGAAGCTGGATGCACAGGTCAAGGAG
CTGGTGCTGAAGTCGGCGGTGGAGGCTGAGCGCCTGGTGGCTGGCAAGCTCAAGAAAGAC
ACGTACATTGAGAATGAGAAGCTCATCTCAGGAAAGCGCCAGGAGCTGGTCACCAAGATC
GACCACATCCTGGATGCCCTGTAG
Protein Properties
Number of Residues 607
Molecular Weight 68568.81
Theoretical pI 6.381
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1
MEAPAAGLFLLLLLGTWAPAPGSASSEAPPLINEDVKRTVDLSSHLAKVTAEVVLAHLGG
GSTSRATSFLLALEPELEARLAHLGVQVKGEDEEENNLEVRETKIKGKSGRFFTVKLPVA
LDPGAKISVIVETVYTHVLHPYPTQITQSEKQFVVFEGNHYFYSPYPTKTQTMRVKLASR
NVESYTKLGNPTRSEDLLDYGPFRDVPAYSQDTFKVHYENNSPFLTITSMTRVIEVSHWG
NIAVEENVDLKHTGAVLKGPFSRYDYQRQPDSGISSIRSFKTILPAAAQDVYYRDEIGNV
STSHLLILDDSVEMEIRPRFPLFGGWKTHYIVGYNLPSYEYLYNLGDQYALKMRFVDHVF
DEQVIDSLTVKIILPEGAKNIEIDSPYEISRAPDELHYTYLDTFGRPVIVAYKKNLVEQH
IQDIVVHYTFNKVLMLQEPLLVVAAFYILFFTVIIYVRLDFSITKDPAAEARMKVACITE
QVLTLVNKRIGLYRHFDETVNRYKQSRDISTLNSGKKSLETEHKALTSEIALLQSRLKTE
GSDLCDRVSEMQKLDAQVKELVLKSAVEAERLVAGKLKKDTYIENEKLISGKRQELVTKI
DHILDAL
GenBank ID Protein 36053
UniProtKB/Swiss-Prot ID P04843
UniProtKB/Swiss-Prot Entry Name RPN1_HUMAN
PDB IDs Not Available
GenBank Gene ID Y00281
GeneCard ID RPN1
GenAtlas ID RPN1
HGNC ID HGNC:10381
References
General References
  1. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [PubMed:19159218 ]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  4. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  5. Chi A, Valencia JC, Hu ZZ, Watabe H, Yamaguchi H, Mangini NJ, Huang H, Canfield VA, Cheng KC, Yang F, Abe R, Yamagishi S, Shabanowitz J, Hearing VJ, Wu C, Appella E, Hunt DF: Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes. J Proteome Res. 2006 Nov;5(11):3135-44. [PubMed:17081065 ]
  6. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  7. Basrur V, Yang F, Kushimoto T, Higashimoto Y, Yasumoto K, Valencia J, Muller J, Vieira WD, Watabe H, Shabanowitz J, Hearing VJ, Hunt DF, Appella E: Proteomic analysis of early melanosomes: identification of novel melanosomal proteins. J Proteome Res. 2003 Jan-Feb;2(1):69-79. [PubMed:12643545 ]
  8. Crimaudo C, Hortsch M, Gausepohl H, Meyer DI: Human ribophorins I and II: the primary structure and membrane topology of two highly conserved rough endoplasmic reticulum-specific glycoproteins. EMBO J. 1987 Jan;6(1):75-82. [PubMed:3034581 ]
  9. Kelleher DJ, Karaoglu D, Mandon EC, Gilmore R: Oligosaccharyltransferase isoforms that contain different catalytic STT3 subunits have distinct enzymatic properties. Mol Cell. 2003 Jul;12(1):101-11. [PubMed:12887896 ]
  10. Shibatani T, David LL, McCormack AL, Frueh K, Skach WR: Proteomic analysis of mammalian oligosaccharyltransferase reveals multiple subcomplexes that contain Sec61, TRAP, and two potential new subunits. Biochemistry. 2005 Apr 26;44(16):5982-92. [PubMed:15835887 ]