You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01597
Secondary Accession Numbers
  • 6905
Name N-acetylglucosamine-6-sulfatase
Synonyms
  1. G6S
  2. Glucosamine-6-sulfatase
Gene Name GNS
Protein Type Unknown
Biological Properties
General Function Involved in catalytic activity
Specific Function Not Available
Pathways
  • Glycosaminoglycan degradation
  • Lysosome
Reactions
+ Water → + Oat gum details
+ Water → + Oat gum details
GO Classification
Biological Process
keratan sulfate catabolic process
carbohydrate metabolic process
Cellular Component
lysosomal lumen
Component
organelle
membrane-bounded organelle
intracellular membrane-bounded organelle
vacuole
lytic vacuole
lysosome
Function
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
sulfuric ester hydrolase activity
n-acetylglucosamine-6-sulfatase activity
Molecular Function
metal ion binding
glycosaminoglycan binding
N-acetylglucosamine-6-sulfatase activity
sulfate binding
Process
polysaccharide metabolic process
aminoglycan metabolic process
glycosaminoglycan metabolic process
metabolic process
primary metabolic process
carbohydrate metabolic process
Cellular Location
  1. Lysosome
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs GNS
Gene Sequence
>1659 bp
ATGCGGCTCCTGCCTCTAGCCCCAGGTCGGCTCCGGCGGGGCAGCCCCCGCCACCTGCCC
TCCTGCAGCCCAGCGCTGCTACTGCTGGTGCTGGGCGGCTGCCTGGGGGTCTTCGGGGTG
GCTGCGGGAACCCGGAGGCCCAACGTGGTGCTGCTCCTCACGGACGACCAGGACGAAGTG
CTCGGCGGCATGACACCACTAAAGAAAACCAAAGCTCTCATCGGAGAGATGGGGATGACT
TTTTCCAGTGCTTATGTGCCAAGTGCTCTCTGCTGCCCCAGCAGAGCCAGTATCCTGACA
GGAAAGTACCCACATAATCATCACGTTGTGAACAACACTCTGGAGGGGAACTGCAGTAGT
AAGTCCTGGCAGAAGATCCAAGAACCAAATACTTTCCCAGCAATTCTCAGATCAATGTGT
GGTTATCAGACCTTTTTTGCAGGGAAATATTTAAATGAGTACGGAGCCCCAGATGCAGGT
GGACTAGAACACGTTCCTCTGGGTTGGAGTTACTGGTATGCCTTGGAAAAGAATTCTAAG
TATTATAATTACACCCTGTCTATCAATGGGAAGGCACGGAAGCATGGTGAAAACTATAGT
GTGGACTACCTGACAGATGTTTTGGCTAATGTCTCCTTGGACTTTCTGGACTACAAGTCC
AACTTTGAGCCCTTCTTCATGATGATCGCCACTCCAGCGCCTCATTCGCCTTGGACAGCT
GCACCTCAGTACCAGAAGGCTTTCCAGAATGTCTTTGCACCAAGAAACAAGAACTTCAAC
ATCCATGGAACGAACAAGCACTGGTTAATTAGGCAAGCCAAGACTCCAATGACTAATTCT
TCAATACAGTTTTTAGATAATGCATTTAGGAAAAGGTGGCAAACTCTCCTCTCAGTTGAT
GACCTTGTGGAGAAACTGGTCAAGAGGCTGGAGTTCACTGGGGAGCTCAACAACACTTAC
ATCTTCTATACCTCAGACAATGGCTATCACACAGGACAGTTTTCCTTGCCAATAGACAAG
AGACAGCTGTATGAGTTTGATATCAAAGTTCCACTGTTGGTTCGAGGACCTGGGATCAAA
CCAAATCAGACAAGCAAGATGCTGGTTGCCAACATTGACTTGGGTCCTACTATTTTGGAC
ATTGCTGGCTACGACCTAAATAAGACACAGATGGATGGGATGTCCTTATTGCCCATTTTG
AGAGGTGCCAGTAACTTGACCTGGCGATCAGATGTCCTGGTGGAATACCAAGGAGAAGGC
CGTAACGTCACTGACCCAACATGCCCTTCCCTGAGTCCTGGCGTATCTCAATGCTTCCCA
GACTGTGTATGTGAAGATGCTTATAACAATACCTATGCCTGTGTGAGGACAATGTCAGCA
TTGTGGAATTTGCAGTATTGCGAGTTTGATGACCAGGAGGTGTTTGTAGAAGTCTATAAT
CTGACTGCAGACCCAGACCAGATCACTAACATTGCTAAAACCATAGACCCAGAGCTTTTA
GGAAAGATGAACTATCGGTTAATGATGTTACAGTCCTGTTCTGGGCCAACCTGTCGCACT
CCAGGGGTTTTTGACCCCGGATACAGGTTTGACCCCCGTCTCATGTTCAGCAATCGCGGC
AGTGTCAGGACTCGAAGATTTTCCAAACATCTTCTGTAG
Protein Properties
Number of Residues 552
Molecular Weight Not Available
Theoretical pI Not Available
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>N-acetylglucosamine-6-sulfatase
MRLLPLAPGRLRRGSPRHLPSCSPALLLLVLGGCLGVFGVAAGTRRPNVVLLLTDDQDEV
LGGMTPLKKTKALIGEMGMTFSSAYVPSALCCPSRASILTGKYPHNHHVVNNTLEGNCSS
KSWQKIQEPNTFPAILRSMCGYQTFFAGKYLNEYGAPDAGGLEHVPLGWSYWYALEKNSK
YYNYTLSINGKARKHGENYSVDYLTDVLANVSLDFLDYKSNFEPFFMMIATPAPHSPWTA
APQYQKAFQNVFAPRNKNFNIHGTNKHWLIRQAKTPMTNSSIQFLDNAFRKRWQTLLSVD
DLVEKLVKRLEFTGELNNTYIFYTSDNGYHTGQFSLPIDKRQLYEFDIKVPLLVRGPGIK
PNQTSKMLVANIDLGPTILDIAGYDLNKTQMDGMSLLPILRGASNLTWRSDVLVEYQGEG
RNVTDPTCPSLSPGVSQCFPDCVCEDAYNNTYACVRTMSALWNLQYCEFDDQEVFVEVYN
LTADPDQITNIAKTIDPELLGKMNYRLMMLQSCSGPTCRTPGVFDPGYRFDPRLMFSNRG
SVRTRRFSKHLL
GenBank ID Protein 31867
UniProtKB/Swiss-Prot ID P15586
UniProtKB/Swiss-Prot Entry Name GNS_HUMAN
PDB IDs Not Available
GenBank Gene ID Z12173
GeneCard ID GNS
GenAtlas ID GNS
HGNC ID HGNC:4422
References
General References
  1. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [PubMed:19159218 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Zhang H, Li XJ, Martin DB, Aebersold R: Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry. Nat Biotechnol. 2003 Jun;21(6):660-6. Epub 2003 May 18. [PubMed:12754519 ]
  4. Robertson DA, Freeman C, Morris CP, Hopwood JJ: A cDNA clone for human glucosamine-6-sulphatase reveals differences between arylsulphatases and non-arylsulphatases. Biochem J. 1992 Dec 1;288 ( Pt 2):539-44. [PubMed:1463457 ]
  5. Robertson DA, Freeman C, Nelson PV, Morris CP, Hopwood JJ: Human glucosamine-6-sulfatase cDNA reveals homology with steroid sulfatase. Biochem Biophys Res Commun. 1988 Nov 30;157(1):218-24. [PubMed:3196333 ]
  6. Mok A, Cao H, Hegele RA: Genomic basis of mucopolysaccharidosis type IIID (MIM 252940) revealed by sequencing of GNS encoding N-acetylglucosamine-6-sulfatase. Genomics. 2003 Jan;81(1):1-5. [PubMed:12573255 ]