You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01598
Secondary Accession Numbers
  • 6912
  • HMDBP05128
Name Mitochondrial dicarboxylate carrier
Synonyms
  1. Solute carrier family 25 member 10
Gene Name SLC25A10
Protein Type Enzyme
Biological Properties
General Function Involved in binding
Specific Function Involved in translocation of malonate, malate and succinate in exchange for phosphate, sulfate, sulfite or thiosulfate across mitochondrial inner membrane
Pathways
  • The Oncogenic Action of Fumarate
  • The Oncogenic Action of Succinate
Reactions Not Available
GO Classification
Component
membrane
mitochondrion
cell part
organelle
membrane-bounded organelle
intracellular membrane-bounded organelle
Function
binding
Process
establishment of localization
transport
intracellular transport
mitochondrial transport
transmembrane transport
Cellular Location
  1. Mitochondrion inner membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 17q25.3
SNPs SLC25A10
Gene Sequence
>864 bp
ATGGCAGCCGAGGCGCGCGTGTCGCGCTGGTACTTCGGGGGGCTGGCCTCCTGCGGGGCC
GCCTGCTGCACGCACCCGCTGGACCTGCTCAAGGTGCATCTGCAGACGCAGCAGGAGGTG
AAGCTGCGCATGACGGGCATGGCGCTGCGGGTGGTGCGTACCGACGGCATCCTGGCACTC
TACAGCGGCCTGAGCGCCTCGCTGTGCAGACAGATGACCTACTCCCTGACTCGGTTCGCC
ATCTACGAGACTGTGCGGGACCGCGTGGCCAAGGGCAGCCAGGGGCCTCTCCCCTTCCAC
GAGAAGGTGTTGCTGGGCTCCGTCAGCGGTTTAGCTGGAGGCTTCGTGGGGACGCCCGCA
GACTTGGTCAACGTCAGGATGCAGAACGACGTGAAGCTGCCCCAGGGTCAGCGGCGCAAC
TACGCCCATGCGCTGGATGGCCTGTACCGCGTAGCTCGTGAAGAGGGTCTCAGGAGACTG
TTCTCGGGTGCAACCATGGCATCCAGCCGAGGGGCCTTAGTCACTGTGGGCCAGCTGTCC
TGCTACGACCAGGCCAAGCAGCGGGTCCTTAGCACCGGGTACCTCTCTGACAACATCTTC
ACTCACTTTGTCGCCAGCTTTATTGCAGGTGGATGTGCCACGTTCCTGTGCCAGCCCCTG
GATGTGCTGAAGACTCGCCTGATGAACTCCAAGGGGGAGTATCAGGGCGTTTTCCACTGC
GCCGTGGAGACAGCGAAGCTCGGGCCTCTGGCCTTTTACAAGGGCCTCGTCCCAGCTGGC
ATCCGCCTCATCCCCCACACCGTGCTCACTTTTGTGTTTCTGGAACAGCTACGCAAAAAC
TTTGGCATCAAAGTGCCATCCTGA
Protein Properties
Number of Residues 287
Molecular Weight 31282.2
Theoretical pI 9.91
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 10-30
  • 63-82
  • 103-123
  • 163-182
  • 203-223
  • 255-275
Protein Sequence
>Mitochondrial dicarboxylate carrier
MAAEARVSRWYFGGLASCGAACCTHPLDLLKVHLQTQQEVKLRMTGMALRVVRTDGILAL
YSGLSASLCRQMTYSLTRFAIYETVRDRVAKGSQGPLPFHEKVLLGSVSGLAGGFVGTPA
DLVNVRMQNDVKLPQGQRRNYAHALDGLYRVAREEGLRRLFSGATMASSRGALVTVGQLS
CYDQAKQLVLSTGYLSDNIFTHFVASFIAGGCATFLCQPLDVLKTRLMNSKGEYQGVFHC
AVETAKLGPLAFYKGLVPAGIRLIPHTVLTFVFLEQLRKNFGIKVPS
GenBank ID Protein 6179584
UniProtKB/Swiss-Prot ID Q9UBX3
UniProtKB/Swiss-Prot Entry Name DIC_HUMAN
PDB IDs Not Available
GenBank Gene ID AJ131613
GeneCard ID SLC25A10
GenAtlas ID SLC25A10
HGNC ID HGNC:10980
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Otsuki T, Ota T, Nishikawa T, Hayashi K, Suzuki Y, Yamamoto J, Wakamatsu A, Kimura K, Sakamoto K, Hatano N, Kawai Y, Ishii S, Saito K, Kojima S, Sugiyama T, Ono T, Okano K, Yoshikawa Y, Aotsuka S, Sasaki N, Hattori A, Okumura K, Nagai K, Sugano S, Isogai T: Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries. DNA Res. 2005;12(2):117-26. [PubMed:16303743 ]
  3. Fiermonte G, Dolce V, Arrigoni R, Runswick MJ, Walker JE, Palmieri F: Organization and sequence of the gene for the human mitochondrial dicarboxylate carrier: evolution of the carrier family. Biochem J. 1999 Dec 15;344 Pt 3:953-60. [PubMed:10585886 ]