You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01609
Secondary Accession Numbers
  • 6932
Name Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
Synonyms
  1. Beta-1,2-N-acetylglucosaminyltransferase II
  2. GNT-II
  3. GlcNAc-T II
  4. Mannoside acetylglucosaminyltransferase 2
  5. N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase II
Gene Name MGAT2
Protein Type Enzyme
Biological Properties
General Function Involved in alpha-1,6-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase activity
Specific Function Catalyzes an essential step in the conversion of oligo-mannose to complex N-glycans.
Pathways
  • N-Glycan biosynthesis
  • protein glycosylation
Reactions
Uridine diphosphate-N-acetylglucosamine + 6-(alpha-D-mannosyl)-beta-D-mannosyl-R → Uridine 5'-diphosphate + 6-(2-(N-acetyl-beta-D-glucosaminyl)-alpha-D-mannosyl)-beta-D-mannosyl-R details
UDP-N-acetyl-D-glucosamine + → UDP + details
GO Classification
Biological Process
oligosaccharide biosynthetic process
post-translational protein modification
protein N-linked glycosylation via asparagine
oligosaccharide metabolic process
Cellular Component
Golgi stack
integral to membrane
Golgi membrane
Component
golgi apparatus part
golgi stack
cell part
intracellular part
membrane part
intrinsic to membrane
integral to membrane
cytoplasmic part
Function
catalytic activity
transferase activity
acetylglucosaminyltransferase activity
udp-glycosyltransferase activity
transferase activity, transferring glycosyl groups
alpha-1,6-mannosylglycoprotein 2-beta-n-acetylglucosaminyltransferase activity
Molecular Function
alpha-1,6-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase activity
Process
metabolic process
primary metabolic process
carbohydrate metabolic process
oligosaccharide metabolic process
oligosaccharide biosynthetic process
Cellular Location
  1. Golgi apparatus membrane
  2. Single-pass type II membrane protein
Gene Properties
Chromosome Location 14
Locus 14q21
SNPs MGAT2
Gene Sequence
>1344 bp
ATGAGGTTCCGCATCTACAAACGGAAGGTGCTAATCCTGACGCTCGTGGTGGCCGCCTGC
GGCTTCGTCCTCTGGAGCAGCAATGGGCGACAAAGGAAGAACGAGGCCCTCGCCCCACCG
TTGCTGGACGCCGAACCCGCGCGGGGTGCCGGCGGCCGCGGTGGGGACCACCCCTCTGTG
GCTGTGGGCATCCGCAGGGTCTCCAACGTGTCGGCGGCTTCCCTGGTCCCGGCGGTCCCC
CAGCCCGAGGCGGACAACCTGACGCTGCGGTACCGGTCCCTGGTGTACCAGCTGAACTTT
GATCAGACCCTGAGGAATGTAGATAAGGCTGGCACCTGGGCCCCCCGGGAGCTGGTGCTG
GTGGTCCAGGTGCATAACCGGCCCGAATACCTCAGACTGCTGCTGGACTCACTTCGAAAA
GCCCAGGGAATTGACAACGTCCTCGTCATCTTTAGCCATGACTTCTGGTCGACCGAGATC
AATCAGCTGATCGCCGGGGTGAATTTCTGTCCGGTTCTGCAGGTGTTCTTTCCTTTCAGC
ATTCAGTTGTACCCTAACGAGTTTCCAGGTAGTGACCCTAGAGATTGTCCCAGAGACCTG
CCGAAGAATGCCGCTTTGAAATTGGGGTGCATCAATGCTGAGTATCCCGACTCCTTCGGC
CATTATAGAGAGGCCAAATTCTCCCAGACCAAACATCACTGGTGGTGGAAGCTGCATTTT
GTGTGGGAAAGAGTGAAAATTCTTCGAGATTATGCTGGCCTTATACTTTTCCTAGAAGAG
GATCACTACTTAGCCCCAGACTTTTACCATGTCTTCAAAAAGATGTGGAAACTGAAGCAG
CAAGAGTGCCCTGAATGTGATGTTCTCTCCCTGGGGACCTATAGTGCCAGTCGCAGTTTC
TATGGCATGGCTGACAAGGTAGATGTGAAAACTTGGAAATCCACAGAGCACAATATGGGT
CTAGCCTTGACCCGGAATGCCTATCAGAAGCTGATCGAGTGCACAGACACTTTCTGTACT
TATGATGATTATAACTGGGACTGGACTCTTCAATACTTGACTGTATCTTGTCTTCCAAAA
TTCTGGAAAGTGCTGGTTCCTCAAATTCCTAGGATCTTTCATGCTGGAGACTGTGGTATG
CATCACAAGAAAACCTGTAGACCATCCACTCAGAGTGCCCAAATTGAGTCACTCTTAAAT
AATAACAAACAATACATGTTTCCAGAAACTCTAACTATCAGTGAAAAGTTTACTGTGGTA
GCCATTTCCCCACCTAGAAAAAATGGAGGGTGGGGAGATATTAGGGACCATGAACTCTGT
AAAAGTTATAGAAGACTGCAGTGA
Protein Properties
Number of Residues 447
Molecular Weight 51549.84
Theoretical pI 8.761
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
MRFRIYKRKVLILTLVVAACGFVLWSSNGRQRKNEALAPPLLDAEPARGAGGRGGDHPSV
AVGIRRVSNVSAASLVPAVPQPEADNLTLRYRSLVYQLNFDQTLRNVDKAGTWAPRELVL
VVQVHNRPEYLRLLLDSLRKAQGIDNVLVIFSHDFWSTEINQLIAGVNFCPVLQVFFPFS
IQLYPNEFPGSDPRDCPRDLPKNAALKLGCINAEYPDSFGHYREAKFSQTKHHWWWKLHF
VWERVKILRDYAGLILFLEEDHYLAPDFYHVFKKMWKLKQQECPECDVLSLGTYSASRSF
YGMADKVDVKTWKSTEHNMGLALTRNAYQKLIECTDTFCTYDDYNWDWTLQYLTVSCLPK
FWKVLVPQIPRIFHAGDCGMHHKKTCRPSTQSAQIESLLNNNKQYMFPETLTISEKFTVV
AISPPRKNGGWGDIRDHELCKSYRRLQ
GenBank ID Protein 193786354
UniProtKB/Swiss-Prot ID Q10469
UniProtKB/Swiss-Prot Entry Name MGAT2_HUMAN
PDB IDs Not Available
GenBank Gene ID AK056167
GeneCard ID MGAT2
GenAtlas ID MGAT2
HGNC ID HGNC:7045
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Tan J, D'Agostaro AF, Bendiak B, Reck F, Sarkar M, Squire JA, Leong P, Schachter H: The human UDP-N-acetylglucosamine: alpha-6-D-mannoside-beta-1,2- N-acetylglucosaminyltransferase II gene (MGAT2). Cloning of genomic DNA, localization to chromosome 14q21, expression in insect cells and purification of the recombinant protein. Eur J Biochem. 1995 Jul 15;231(2):317-28. [PubMed:7635144 ]
  4. Tan J, Dunn J, Jaeken J, Schachter H: Mutations in the MGAT2 gene controlling complex N-glycan synthesis cause carbohydrate-deficient glycoprotein syndrome type II, an autosomal recessive disease with defective brain development. Am J Hum Genet. 1996 Oct;59(4):810-7. [PubMed:8808595 ]
  5. Cormier-Daire V, Amiel J, Vuillaumier-Barrot S, Tan J, Durand G, Munnich A, Le Merrer M, Seta N: Congenital disorders of glycosylation IIa cause growth retardation, mental retardation, and facial dysmorphism. J Med Genet. 2000 Nov;37(11):875-7. [PubMed:11228641 ]