Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01615
Secondary Accession Numbers
  • 6938
Name Neutrophil cytosol factor 4
Synonyms
  1. NCF-4
  2. Neutrophil NADPH oxidase factor 4
  3. SH3 and PX domain-containing protein 4
  4. p40-phox
  5. p40phox
Gene Name NCF4
Protein Type Enzyme
Biological Properties
General Function Involved in protein binding
Specific Function Component of the NADPH-oxidase, a multicomponent enzyme system responsible for the oxidative burst in which electrons are transported from NADPH to molecular oxygen, generating reactive oxidant intermediates. It may be important for the assembly and/or activation of the NADPH-oxidase complex
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
protein binding
lipid binding
phospholipid binding
phosphoinositide binding
Process
cellular process
cell communication
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location Chromosome:2
Locus 22q13.1
SNPs NCF4
Gene Sequence
>1020 bp
ATGGCTGTGGCCCAGCAGCTGCGGGCCGAGAGTGACTTTGAACAGCTTCCGGATGATGTT
GCCATCTCGGCCAACATTGCTGACATCGAGGAGAAGAGAGGCTTCACCAGCCACTTTGTT
TTCGTCATCGAGGTGAAGACAAAAGGAGGATCCAAGTACCTCATCTACCGCCGCTACCGC
CAGTTCCATGCTTTGCAGAGCAAGCTGGAGGAGCGCTTCGGGCCAGACAGCAAGAGCAGT
GCCCTGGCCTGTACCCTGCCCACACTCCCAGCCAAAGTCTACGTGGGTGTGAAACAGGAG
ATCGCCGAGATGCGGATACCTGCCCTCAACGCCTACATGAAGAGCCTGCTCAGCCTGCCG
GTCTGGGTGCTGATGGATGAGGACGTCCGGATCTTCTTTTACCAGTCGCCCTATGACTCA
GAGCAGGTGCCCCAGGCACTCCGCCGGCTCCGCCCGCGCACCCGGAAAGTCAAGAGCGTG
TCCCCACAGGGCAACAGCGTTGACCGCATGGCAGCTCCGAGAGCAGAGGCTCTATTTGAC
TTCACTGGAAACAGCAAACTGGAGCTGAATTTCAAAGCTGGAGATGTGATCTTCCTCCTC
AGTCGGATCAACAAAGACTGGCTGGAGGGCACTGTCCGGGGAGCCACGGGCATCTTCCCT
CTCTCCTTCGTGAAGATCCTCAAAGACTTCCCTGAGGAGGACGACCCCACCAACTGGCTG
CGTTGCTACTACTACGAAGACACCATCAGCACCATCAAGGACATCGCGGTGGAGGAAGAT
CTCAGCAGCACTCCCCTATTGAAAGACCTGCTGGAGCTCACAAGGCGGGAGTTCCAGAGA
GAGGACATAGCTCTGAATTACCGGGACGCTGAGGGGGATCTGGTTCGGCTGCTGTCGGAT
GAGGACGTAGCGCTCATGGTGCGGCAGGCTCGTGGCCTCCCCTCCCAGAAGCGCCTCTTC
CCCTGGAAGCTGCACATCACGCAGAAGGACAACTACAGGGTCTACAACACGATGCCATGA
Protein Properties
Number of Residues 339
Molecular Weight 39031.3
Theoretical pI 6.81
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Neutrophil cytosol factor 4
MAVAQQLRAESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRYR
QFHALQSKLEERFGPDSKSSALACTLPTLPAKVYVGVKQEIAEMRIPALNAYMKSLLSLP
VWVLMDEDVRIFFYQSPYDSEQVPQALRRLRPRTRKVKSVSPQGNSVDRMAAPRAEALFD
FTGNSKLELNFKAGDVIFLLSRINKDWLEGTVRGATGIFPLSFVKILKDFPEEDDPTNWL
RCYYYEDTISTIKDIAVEEDLSSTPLLKDLLELTRREFQREDIALNYRDAEGDLVRLLSD
EDVALMVRQARGLPSQKRLFPWKLHITQKDNYRVYNTMP
GenBank ID Protein 47519798
UniProtKB/Swiss-Prot ID Q15080
UniProtKB/Swiss-Prot Entry Name NCF4_HUMAN
PDB IDs
GenBank Gene ID NM_000631.4
GeneCard ID NCF4
GenAtlas ID NCF4
HGNC ID HGNC:7662
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. [PubMed:10591208 ]
  3. Collins JE, Wright CL, Edwards CA, Davis MP, Grinham JA, Cole CG, Goward ME, Aguado B, Mallya M, Mokrab Y, Huckle EJ, Beare DM, Dunham I: A genome annotation-driven approach to cloning the human ORFeome. Genome Biol. 2004;5(10):R84. Epub 2004 Sep 30. [PubMed:15461802 ]
  4. Wilson MI, Gill DJ, Perisic O, Quinn MT, Williams RL: PB1 domain-mediated heterodimerization in NADPH oxidase and signaling complexes of atypical protein kinase C with Par6 and p62. Mol Cell. 2003 Jul;12(1):39-50. [PubMed:12887891 ]
  5. Wientjes FB, Hsuan JJ, Totty NF, Segal AW: p40phox, a third cytosolic component of the activation complex of the NADPH oxidase to contain src homology 3 domains. Biochem J. 1993 Dec 15;296 ( Pt 3):557-61. [PubMed:8280052 ]
  6. Zhan S, Vazquez N, Zhan S, Wientjes FB, Budarf ML, Schrock E, Ried T, Green ED, Chanock SJ: Genomic structure, chromosomal localization, start of transcription, and tissue expression of the human p40-phox, a new component of the nicotinamide adenine dinucleotide phosphate-oxidase complex. Blood. 1996 Oct 1;88(7):2714-21. [PubMed:8839867 ]
  7. Hasebe T, Someya A, Nagaoka I: Identification of a splice variant mRNA of p40phox, an NADPH oxidase component of phagocytes. FEBS Lett. 1999 Jul 23;455(3):257-61. [PubMed:10437784 ]
  8. Bouin AP, Grandvaux N, Vignais PV, Fuchs A: p40(phox) is phosphorylated on threonine 154 and serine 315 during activation of the phagocyte NADPH oxidase. Implication of a protein kinase c-type kinase in the phosphorylation process. J Biol Chem. 1998 Nov 13;273(46):30097-103. [PubMed:9804763 ]
  9. Bravo J, Karathanassis D, Pacold CM, Pacold ME, Ellson CD, Anderson KE, Butler PJ, Lavenir I, Perisic O, Hawkins PT, Stephens L, Williams RL: The crystal structure of the PX domain from p40(phox) bound to phosphatidylinositol 3-phosphate. Mol Cell. 2001 Oct;8(4):829-39. [PubMed:11684018 ]
  10. Massenet C, Chenavas S, Cohen-Addad C, Dagher MC, Brandolin G, Pebay-Peyroula E, Fieschi F: Effects of p47phox C terminus phosphorylations on binding interactions with p40phox and p67phox. Structural and functional comparison of p40phox and p67phox SH3 domains. J Biol Chem. 2005 Apr 8;280(14):13752-61. Epub 2005 Jan 18. [PubMed:15657040 ]