Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01628
Secondary Accession Numbers
  • 6951
Name Hemopexin
Synonyms
  1. Beta-1B-glycoprotein
Gene Name HPX
Protein Type Unknown
Biological Properties
General Function Involved in heme transporter activity
Specific Function Binds heme and transports it to the liver for breakdown and iron recovery, after which the free hemopexin returns to the circulation
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Secreted
Gene Properties
Chromosome Location Chromosome:1
Locus 11p15.5-p15.4
SNPs HPX
Gene Sequence
>1389 bp
ATGGCTAGGGTACTGGGAGCACCCGTTGCACTGGGGTTGTGGAGCCTATGCTGGTCTCTG
GCCATTGCCACCCCTCTTCCTCCGACTAGTGCCCATGGGAATGTTGCTGAAGGCGAGACC
AAGCCAGACCCAGACGTGACTGAACGCTGCTCAGATGGCTGGAGCTTTGATGCTACCACC
CTGGATGACAATGGAACCATGCTGTTTTTTAAAGGGGAGTTTGTGTGGAAGAGTCACAAA
TGGGACCGGGAGTTAATCTCAGAGAGATGGAAGAATTTCCCCAGCCCTGTGGATGCTGCA
TTCCGTCAAGGTCACAACAGTGTCTTTCTGATCAAGGGGGACAAAGTCTGGGTATACCCT
CCTGAAAAGAAGGAGAAAGGATACCCAAAGTTGCTCCAAGATGAATTTCCTGGAATCCCA
TCCCCACTGGATGCAGCTGTGGAATGTCACCGTGGAGAATGTCAAGCTGAAGGCGTCCTC
TTCTTCCAAGGTGACCGCGAGTGGTTCTGGGACTTGGCTACGGGAACCATGAAGGAGCGT
TCCTGGCCAGCTGTTGGGAACTGCTCCTCTGCCCTGAGATGGCTGGGCCGCTACTACTGC
TTCCAGGGTAACCAATTCCTGCGCTTCGACCCTGTCAGGGGAGAGGTGCCTCCCAGGTAC
CCGCGGGATGTCCGAGACTACTTCATGCCCTGCCCTGGCAGAGGCCATGGACACAGGAAT
GGGACTGGCCATGGGAACAGTACCCACCATGGCCCTGAGTATATGCGCTGTAGCCCACAT
CTAGTCTTGTCTGCACTGACGTCTGACAACCATGGTGCCACCTATGCCTTCAGTGGGACC
CACTACTGGCGTCTGGACACCAGCCGGGATGGCTGGCATAGCTGGCCCATTGCTCATCAG
TGGCCCCAGGGTCCTTCAGCAGTGGATGCTGCCTTTTCCTGGGAAGAAAAACTCTATCTG
GTCCAGGGCACCCAGGTATATGTCTTCCTGACAAAGGGAGGCTATACCCTAGTAAGCGGT
TATCCGAAGCGGCTGGAGAAGGAAGTCGGGACCCCTCATGGGATTATCCTGGACTCTGTG
GATGCGGCCTTTATCTGCCCTGGGTCTTCTCGGCTCCATATCATGGCAGGACGGCGGCTG
TGGTGGCTGGACCTGAAGTCAGGAGCCCAAGCCACGTGGACAGAGCTTCCTTGGCCCCAT
GAGAAGGTAGACGGAGCCTTGTGTATGGAAAGGTCCCTTGGCCCTAACTCATGTTCCGCC
AATGGTCCCGGCTTGTACCTCATCCATGGTCCCAATTTGTACTGCTACAGTGATGTGGAG
AAACTGAATGCAGCCAAGGCCCTTCCGCAACCCCAGAATGTGACCAGTCTCCTGGGCTGC
ACTCACTGA
Protein Properties
Number of Residues 462
Molecular Weight 51676.0
Theoretical pI 7.02
Pfam Domain Function
Signals
  • 1-23
Transmembrane Regions
  • None
Protein Sequence
>Hemopexin
MARVLGAPVALGLWSLCWSLAIATPLPPTSAHGNVAEGETKPDPDVTERCSDGWSFDATT
LDDNGTMLFFKGEFVWKSHKWDRELISERWKNFPSPVDAAFRQGHNSVFLIKGDKVWVYP
PEKKEKGYPKLLQDEFPGIPSPLDAAVECHRGECQAEGVLFFQGDREWFWDLATGTMKER
SWPAVGNCSSALRWLGRYYCFQGNQFLRFDPVRGEVPPRYPRDVRDYFMPCPGRGHGHRN
GTGHGNSTHHGPEYMRCSPHLVLSALTSDNHGATYAFSGTHYWRLDTSRDGWHSWPIAHQ
WPQGPSAVDAAFSWEEKLYLVQGTQVYVFLTKGGYTLVSGYPKRLEKEVGTPHGIILDSV
DAAFICPGSSRLHIMAGRRLWWLDLKSGAQATWTELPWPHEKVDGALCMEKSLGPNSCSA
NGPGLYLIHGPNLYCYSDVEKLNAAKALPQPQNVTSLLGCTH
GenBank ID Protein 189053897
UniProtKB/Swiss-Prot ID P02790
UniProtKB/Swiss-Prot Entry Name HEMO_HUMAN
PDB IDs Not Available
GenBank Gene ID AK313648
GeneCard ID HPX
GenAtlas ID Not Available
HGNC ID Not Available
References
General References
  1. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [PubMed:19159218 ]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  3. Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80. [PubMed:16335952 ]
  4. Bunkenborg J, Pilch BJ, Podtelejnikov AV, Wisniewski JR: Screening for N-glycosylated proteins by liquid chromatography mass spectrometry. Proteomics. 2004 Feb;4(2):454-65. [PubMed:14760718 ]
  5. Ramachandran P, Boontheung P, Xie Y, Sondej M, Wong DT, Loo JA: Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry. J Proteome Res. 2006 Jun;5(6):1493-503. [PubMed:16740002 ]
  6. Kristiansen TZ, Bunkenborg J, Gronborg M, Molina H, Thuluvath PJ, Argani P, Goggins MG, Maitra A, Pandey A: A proteomic analysis of human bile. Mol Cell Proteomics. 2004 Jul;3(7):715-28. Epub 2004 Apr 14. [PubMed:15084671 ]
  7. Nilsson J, Ruetschi U, Halim A, Hesse C, Carlsohn E, Brinkmalm G, Larson G: Enrichment of glycopeptides for glycan structure and attachment site identification. Nat Methods. 2009 Nov;6(11):809-11. doi: 10.1038/nmeth.1392. Epub 2009 Oct 18. [PubMed:19838169 ]
  8. Altruda F, Poli V, Restagno G, Silengo L: Structure of the human hemopexin gene and evidence for intron-mediated evolution. J Mol Evol. 1988;27(2):102-8. [PubMed:2842511 ]
  9. Law ML, Cai GY, Hartz JA, Jones C, Kao FT: The hemopexin gene maps to the same location as the beta-globin gene cluster on human chromosome 11. Genomics. 1988 Jul;3(1):48-52. [PubMed:3220477 ]
  10. Altruda F, Poli V, Restagno G, Argos P, Cortese R, Silengo L: The primary structure of human hemopexin deduced from cDNA sequence: evidence for internal, repeating homology. Nucleic Acids Res. 1985 Jun 11;13(11):3841-59. [PubMed:2989777 ]
  11. Takahashi N, Takahashi Y, Putnam FW: Complete amino acid sequence of human hemopexin, the heme-binding protein of serum. Proc Natl Acad Sci U S A. 1985 Jan;82(1):73-7. [PubMed:3855550 ]
  12. Frantikova V, Borvak J, Kluh I, Moravek L: Amino acid sequence of the N-terminal region of human hemopexin. FEBS Lett. 1984 Dec 10;178(2):213-6. [PubMed:6510521 ]
  13. Takahashi N, Takahashi Y, Putnam FW: Structure of human hemopexin: O-glycosyl and N-glycosyl sites and unusual clustering of tryptophan residues. Proc Natl Acad Sci U S A. 1984 Apr;81(7):2021-5. [PubMed:6371807 ]
  14. Ratra R, Kar-Roy A, Lal SK: The ORF3 protein of hepatitis E virus interacts with hemopexin by means of its 26 amino acid N-terminal hydrophobic domain II. Biochemistry. 2008 Feb 19;47(7):1957-69. doi: 10.1021/bi7016552. Epub 2008 Jan 23. [PubMed:18211098 ]