You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01636
Secondary Accession Numbers
  • 6961
Name Protein lin-7 homolog A
Synonyms
  1. Lin-7A
  2. MALS-1
  3. Mammalian lin-seven protein 1
  4. TIP-33
  5. Tax interaction protein 33
  6. Veli-1
  7. Vertebrate lin-7 homolog 1
  8. hLin-7
Gene Name LIN7A
Protein Type Unknown
Biological Properties
General Function Involved in exocytosis
Specific Function Plays a role in establishing and maintaining the asymmetric distribution of channels and receptors at the plasma membrane of polarized cells. Forms membrane-associated multiprotein complexes that may regulate delivery and recycling of proteins to the correct membrane domains. The tripartite complex composed of LIN7 (LIN7A, LIN7B or LIN7C), CASK and APBA1 may have the potential to couple synaptic vesicle exocytosis to cell adhesion in brain. Ensures the proper localization of GRIN2B (subunit 2B of the NMDA receptor) to neuronal postsynaptic density and may function in localizing synaptic vesicles at synapses where it is recruited by beta-catenin and cadherin. Required to localize Kir2 channels, GABA transporter (SLC6A12) and EGFR/ERBB1, ERBB2, ERBB3 and ERBB4 to the basolateral membrane of epithelial cells
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
protein binding
Cellular Location
  1. Cell membrane
  2. Peripheral membrane protein
  3. Peripheral membrane protein
  4. Peripheral membrane protein
  5. Basolateral cell membrane
  6. Cell junction
  7. Cell junction
  8. Cell junction
  9. Cell junction
  10. synapse
  11. synapse
  12. tight junction
  13. postsynaptic cell membrane
  14. postsynaptic density
  15. synaptosome
Gene Properties
Chromosome Location Chromosome:1
Locus 12q21
SNPs LIN7A
Gene Sequence
>702 bp
ATGCTGAAGCCGAGCGTCACTTCGGCTCCCACGGCAGACATGGCGACATTGACAGTGGTC
CAGCCGCTCACCCTGGACAGAGATGTTGCAAGAGCAATTGAATTACTGGAAAAACTACAG
GAATCTGGAGAAGTACCAGTGCACAAGCTACAATCCCTCAAAAAAGTGCTTCAGAGTGAG
TTTTGTACAGCTATTCGAGAGGTGTATCAATATATGCATGAAACGATAACTGTTAATGGC
TGTCCCGAATTCCGTGCGAGGGCAACAGCAAAGGCAACAGTTGCAGCTTTTGCAGCTAGT
GAAGGCCACTCCCACCCTCGAGTAGTTGAACTGCCAAAGACTGATGAAGGCCTTGGTTTT
AATGTGATGGGAGGAAAGGAGCAAAATTCCCCCATTTATATCTCTCGCATAATTCCTGGA
GGGGTGGCTGAAAGACACGGAGGCCTCAAAAGAGGAGACCAGCTGCTATCAGTGAACGGA
GTGAGTGTGGAAGGAGAACACCATGAGAAAGCTGTGGAACTACTCAAGGCTGCTAAAGAC
AGCGTCAAGCTGGTGGTGCGATACACCCCAAAAGTTCTGGAAGAAATGGAGGCTCGCTTT
GAAAAGCTACGAACAGCCAGGCGTCGGCAGCAGCAGCAATTGCTAATTCAGCAGCAGCAA
CAGCAGCAGCAGCAACAAACACAACAAAACCACATGTCATAG
Protein Properties
Number of Residues 233
Molecular Weight 25996.6
Theoretical pI 9.1
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Protein lin-7 homolog A
MLKPSVTSAPTADMATLTVVQPLTLDRDVARAIELLEKLQESGEVPVHKLQSLKKVLQSE
FCTAIREVYQYMHETITVNGCPEFRARATAKATVAAFAASEGHSHPRVVELPKTDEGLGF
NVMGGKEQNSPIYISRIIPGGVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKD
SVKLVVRYTPKVLEEMEARFEKLRTARRRQQQQLLIQQQQQQQQQQTQQNHMS
GenBank ID Protein 4759306
UniProtKB/Swiss-Prot ID O14910
UniProtKB/Swiss-Prot Entry Name LIN7A_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_004664.2
GeneCard ID LIN7A
GenAtlas ID Not Available
HGNC ID Not Available
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Butz S, Okamoto M, Sudhof TC: A tripartite protein complex with the potential to couple synaptic vesicle exocytosis to cell adhesion in brain. Cell. 1998 Sep 18;94(6):773-82. [PubMed:9753324 ]
  4. Jo K, Derin R, Li M, Bredt DS: Characterization of MALS/Velis-1, -2, and -3: a family of mammalian LIN-7 homologs enriched at brain synapses in association with the postsynaptic density-95/NMDA receptor postsynaptic complex. J Neurosci. 1999 Jun 1;19(11):4189-99. [PubMed:10341223 ]
  5. Rousset R, Fabre S, Desbois C, Bantignies F, Jalinot P: The C-terminus of the HTLV-1 Tax oncoprotein mediates interaction with the PDZ domain of cellular proteins. Oncogene. 1998 Feb 5;16(5):643-54. [PubMed:9482110 ]
  6. Tseng TC, Marfatia SM, Bryant PJ, Pack S, Zhuang Z, O'Brien JE, Lin L, Hanada T, Chishti AH: VAM-1: a new member of the MAGUK family binds to human Veli-1 through a conserved domain. Biochim Biophys Acta. 2001 Apr 16;1518(3):249-59. [PubMed:11311936 ]
  7. Shelly M, Mosesson Y, Citri A, Lavi S, Zwang Y, Melamed-Book N, Aroeti B, Yarden Y: Polar expression of ErbB-2/HER2 in epithelia. Bimodal regulation by Lin-7. Dev Cell. 2003 Sep;5(3):475-86. [PubMed:12967566 ]
  8. Bohl J, Brimer N, Lyons C, Vande Pol SB: The stardust family protein MPP7 forms a tripartite complex with LIN7 and DLG1 that regulates the stability and localization of DLG1 to cell junctions. J Biol Chem. 2007 Mar 30;282(13):9392-400. Epub 2007 Jan 19. [PubMed:17237226 ]