You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01638
Secondary Accession Numbers
  • 6963
Name Disks large homolog 4
Synonyms
  1. PSD-95
  2. Postsynaptic density protein 95
  3. SAP-90
  4. SAP90
  5. Synapse-associated protein 90
Gene Name DLG4
Protein Type Enzyme
Biological Properties
General Function Involved in protein binding
Specific Function Interacts with the cytoplasmic tail of NMDA receptor subunits and shaker-type potassium channels. Required for synaptic plasticity associated with NMDA receptor signaling. Overexpression or depletion of DLG4 changes the ratio of excitatory to inhibitory synapses in hippocampal neurons. May reduce the amplitude of ACCN3 acid-evoked currents by retaining the channel intracellularly. May regulate the intracellular trafficking of ADR1B
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
protein binding
Cellular Location
  1. Cell membrane
  2. Peripheral membrane protein
  3. Cell junction
  4. Cell junction
  5. Cell junction
  6. synapse
  7. synapse
  8. synapse
  9. postsynaptic cell membrane
  10. postsynaptic density
  11. synaptosome
Gene Properties
Chromosome Location Chromosome:1
Locus 17p13.1
SNPs DLG4
Gene Sequence
>2175 bp
ATGGACTGTCTCTGTATAGTGACAACCAAGAAATACCGCTACCAAGATGAAGACACGCCC
CCTCTGGAGCACAGCCCGGCCCACCTCCCCAACCAGGCCAATTCTCCCCCAGTGATTGTC
AACACAGATACCCTAGAAGCCCCAGGATATGAGTTGCAGGTGAACGGGACCGAGGGGGAG
ATGGAATACGAGGAAATCACATTGGAAAGGGGTAACTCAGGTCTGGGCTTCAGCATCGCA
GGTGGCACTGACAACCCACACATCGGTGACGACCCATCCATTTTCATCACCAAGATCATT
CCTGGTGGGGCTGCGGCCCAGGATGGCCGCCTCAGGGTCAACGACAGCATCCTGTTTGTA
AATGAAGTGGACGTGCGCGAGGTGACCCACTCAGCGGCGGTGGAAGCCCTCAAAGAGGCA
GGCTCCATCGTTCGCCTCTATGTCATGCGCCGGAAGCCCCCGGCTGAGAAGGTCATGGAG
ATCAAGCTCATCAAGGGGCCTAAAGGTCTTGGCTTCAGCATCGCAGGGGGCGTAGGGAAC
CAGCACATCCCAGGAGATAATAGCATCTATGTAACAAAGATCATCGAAGGGGGTGCTGCC
CACAAGGATGGGAGGTTGCAGATTGGAGACAAGATCCTGGCGGTCAACAGTGTGGGGCTA
GAGGACGTCATGCATGAAGATGCTGTGGCAGCCCTGAAGAACACGTATGATGTTGTCTAC
CTAAAGGTGGCCAAGCCCAGCAATGCCTACCTGAGTGACAGCTATGCTCCCCCAGACATC
ACAACCTCTTATTCCCAGCACCTGGACAATGAGATCAGTCACAGCAGCTACCTGGGCACC
GACTACCCCACAGCCATGACCCCCACTTCCCCTCGGCGCTACTCTCCAGTGGCCAAGGAC
CTGCTCGGGGAGGAAGACATTCCCCGAGAACCGAGGCGAATTGTGATCCACCGGGGCTCC
ACGGGCCTGGGCTTCAACATCGTGGGTGGCGAGGACGGTGAAGGCATCTTCATCTCCTTT
ATCCTGGCCGGGGGCCCTGCAGACCTCAGTGGGGAGCTGCGGAAGGGGGACCAGATCCTG
TCGGTCAACGGTGTGGACCTCCGAAATGCCAGCCATGAGCAGGCTGCCATTGCCCTGAAG
AATGCGGGTCAGACGGTCACGATCATCGCTCAGTATAAACCAGAAGAGTACAGCCGATTC
GAGGCCAAGATCCACGACCTTCGGGAACAGCTCATGAACAGCAGCCTGGGCTCAGGGACT
GCGTCCCTGCGGAGCAACCCCAAAAGGGGTTTCTACATCAGGGCCCTGTTTGATTACGAC
AAGACCAAGGACTGCGGCTTCCTGAGCCAGGCCCTGAGCTTCCGCTTTGGGGATGTGCTG
CATGTCATCGATGCTAGTGATGAGGAGTGGTGGCAGGCACGGCGGGTCCACTCTGACAGT
GAGACCGACGACATTGGGTTCATCCCCAGCAAACGGCGGGTTGAGCGACGAGAGTGGTCA
AGGTTAAAGGCCAAGGACTGGGGCTCCAGCTCTGGATCGCAGGGTCGAGAAGACTCGGTT
CTGAGCTACGAGACAGTGACGCAGATGGAAGTGCACTATGCTCGCCCCATCATCATCCTT
GGGCCCACCAAGGACCGCGCCAACGATGATCTTCTCTCCGAGTTCCCCGACAAGTTTGGA
TCCTGTGTTCCCCATACGACACGGCCCAAGCGGGAGTATGAGATAGATGGCCGGGATTAC
CACTTTGTGTCGTCCCGGGAGAAAATGGAGAAGGACATTCAGGCGCACAAGTTCATTGAG
GCCGGCCAGTACAACAGCCACCTCTATGGGACCAGCGTCCAGTCCGTGCGAGAGGTGGCA
GAGCAGGGGAAGCACTGCATCCTCGATGTCTCGGCCAATGCCGTGCGGCGGCTGCAGGCG
GCCCACCTGCACCCCATCGCCATCTTCATCCGCCCCCGCTCCCTGGAGAATGTGCTAGAG
ATTAACAAGCGGATCACAGAGGAGCAAGCCCGCAAAGCCTTCGACAGAGCCACCAAGCTG
GAGCAGGAGTTCACAGAGTGCTTCTCAGCCATCGTGGAGGGTGACAGCTTTGAGGAGATC
TACCACAAGGTGAAGCGTGTCATCGAGGACCTCTCAGGCCCCTACATCTGGGTTCCAGCC
CGAGAGAGACTCTGA
Protein Properties
Number of Residues 724
Molecular Weight 80494.6
Theoretical pI 5.71
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Disks large homolog 4
MDCLCIVTTKKYRYQDEDTPPLEHSPAHLPNQANSPPVIVNTDTLEAPGYELQVNGTEGE
MEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFV
NEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEKVMEIKLIKGPKGLGFSIAGGVGN
QHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTYDVVY
LKVAKPSNAYLSDSYAPPDITTSYSQHLDNEISHSSYLGTDYPTAMTPTSPRRYSPVAKD
LLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQIL
SVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMNSSLGSGT
ASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDASDEEWWQARRVHSDS
ETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYARPIIIL
GPTKDRANDDLLSEFPDKFGSCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIE
AGQYNSHLYGTSVQSVREVAEQGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLE
INKRITEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEIYHKVKRVIEDLSGPYIWVPA
RERL
GenBank ID Protein 221039688
UniProtKB/Swiss-Prot ID P78352
UniProtKB/Swiss-Prot Entry Name DLG4_HUMAN
PDB IDs
GenBank Gene ID AK293835
GeneCard ID DLG4
GenAtlas ID DLG4
HGNC ID HGNC:2903
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Wang Y, Du D, Fang L, Yang G, Zhang C, Zeng R, Ullrich A, Lottspeich F, Chen Z: Tyrosine phosphorylated Par3 regulates epithelial tight junction assembly promoted by EGFR signaling. EMBO J. 2006 Nov 1;25(21):5058-70. Epub 2006 Oct 19. [PubMed:17053785 ]
  3. Garcia RA, Vasudevan K, Buonanno A: The neuregulin receptor ErbB-4 interacts with PDZ-containing proteins at neuronal synapses. Proc Natl Acad Sci U S A. 2000 Mar 28;97(7):3596-601. [PubMed:10725395 ]
  4. Stathakis DG, Hoover KB, You Z, Bryant PJ: Human postsynaptic density-95 (PSD95): location of the gene (DLG4) and possible function in nonneural as well as in neural tissues. Genomics. 1997 Aug 15;44(1):71-82. [PubMed:9286702 ]
  5. Stathakis DG, Udar N, Sandgren O, Andreasson S, Bryant PJ, Small K, Forsman-Semb K: Genomic organization of human DLG4, the gene encoding postsynaptic density 95. J Neurochem. 1999 Dec;73(6):2250-65. [PubMed:10582582 ]
  6. Kim E, Niethammer M, Rothschild A, Jan YN, Sheng M: Clustering of Shaker-type K+ channels by interaction with a family of membrane-associated guanylate kinases. Nature. 1995 Nov 2;378(6552):85-8. [PubMed:7477295 ]
  7. Irie M, Hata Y, Takeuchi M, Ichtchenko K, Toyoda A, Hirao K, Takai Y, Rosahl TW, Sudhof TC: Binding of neuroligins to PSD-95. Science. 1997 Sep 5;277(5331):1511-5. [PubMed:9278515 ]
  8. Hanada T, Lin L, Tibaldi EV, Reinherz EL, Chishti AH: GAKIN, a novel kinesin-like protein associates with the human homologue of the Drosophila discs large tumor suppressor in T lymphocytes. J Biol Chem. 2000 Sep 15;275(37):28774-84. [PubMed:10859302 ]
  9. Chetkovich DM, Bunn RC, Kuo SH, Kawasaki Y, Kohwi M, Bredt DS: Postsynaptic targeting of alternative postsynaptic density-95 isoforms by distinct mechanisms. J Neurosci. 2002 Aug 1;22(15):6415-25. [PubMed:12151521 ]
  10. Ko J, Kim S, Chung HS, Kim K, Han K, Kim H, Jun H, Kaang BK, Kim E: SALM synaptic cell adhesion-like molecules regulate the differentiation of excitatory synapses. Neuron. 2006 Apr 20;50(2):233-45. [PubMed:16630835 ]
  11. Lee HW, Choi J, Shin H, Kim K, Yang J, Na M, Choi SY, Kang GB, Eom SH, Kim H, Kim E: Preso, a novel PSD-95-interacting FERM and PDZ domain protein that regulates dendritic spine morphogenesis. J Neurosci. 2008 Dec 31;28(53):14546-56. doi: 10.1523/JNEUROSCI.3112-08.2008. [PubMed:19118189 ]
  12. Piserchio A, Pellegrini M, Mehta S, Blackman SM, Garcia EP, Marshall J, Mierke DF: The PDZ1 domain of SAP90. Characterization of structure and binding. J Biol Chem. 2002 Mar 1;277(9):6967-73. Epub 2001 Dec 14. [PubMed:11744724 ]