Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01639
Secondary Accession Numbers
  • 6964
Name Glutamate [NMDA] receptor subunit 3B
Synonyms
  1. N-methyl-D-aspartate receptor subtype 3B
  2. NMDAR3B
  3. NR3B
Gene Name GRIN3B
Protein Type Unknown
Biological Properties
General Function Involved in ionotropic glutamate receptor activity
Specific Function NMDA receptor subtype of glutamate-gated ion channels with reduced single-channel conductance, low calcium permeability and low voltage-dependent sensitivity to magnesium. Mediated by glycine
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
periplasmic space
outer membrane-bounded periplasmic space
Function
receptor activity
transmembrane receptor activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
molecular transducer activity
signal transducer activity
transporter activity
ion channel activity
ligand-gated ion channel activity
extracellular ligand-gated ion channel activity
excitatory extracellular ligand-gated ion channel activity
extracellular-glutamate-gated ion channel activity
glutamate receptor activity
ionotropic glutamate receptor activity
Process
establishment of localization
transport
ion transport
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
  3. Cell junction
  4. synapse
  5. postsynaptic cell membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 19p13.3
SNPs GRIN3B
Gene Sequence
>3132 bp
ATGGAGTTTGTGCGGGCGCTGTGGCTGGGCCTGGCGCTGGCGCTGGGGCCGGGGTCCGCG
GGGGGCCACCCTCAGCCGTGCGGCGTCCTGGCGCGCCTCGGGGGCTCCGTGCGCCTGGGC
GCCCTCCTGCCCCGCGCGCCTCTCGCCCGCGCCCGCGCCCGCGCCGCCCTGGCCCGGGCC
GCCCTGGCGCCGCGGCTGCCGCACAACCTGAGCTTGGAGCTGGTGGTCGCCGCGCCCCCC
GCCCGCGACCCCGCCTCGCTGACCCGCGGCCTGTGCCAGGCGCTGGTGCCTCCGGGCGTG
GCGGCCCTGCTCGCCTTTCCCGAGGCTCGGCCCGAGCTGCTGCAGCTGCACTTCCTGGCG
GCGGCCACCGAGACCCCCGTGCTCAGCCTGCTGCGGCGGGAGGCGCGCGCGCCCCTCGGA
GCCCCGAACCCATTCCACCTGCAGCTGCACTGGGCCAGCCCCCTGGAGACGCTGCTGGAT
GTGCTGGTGGCGGTGCTGCAGGCGCACGCCTGGGAAGACGTCGGCCTGGCCCTGTGCCGC
ACTCAGGACCCCGGCGGCCTGGTGGCCCTCTGGACAAGCCGGGCTGGCCGGCCCCCACAG
CTGGTCCTGGACCTAAGCCGGCGGGACACGGGAGATGCAGGACTGCGGGCACGCCTGGCC
CCGATGGCGGCGCCAGTGGGGGGTGAAGCACCGGTACCCGCGGCGGTCCTCCTCGGCTGT
GACATCGCCCGTGCCCGTCGGGTGCTGGAGGCCGTACCTCCCGGCCCCCACTGGCTGTTG
GGGACACCACTGCCGCCCAAGGCCCTGCCCACCGCGGGGCTGCCACCAGGGCTGCTGGCG
CTGGGCGAGGTGGCACGACCCCCGCTGGAGGCCGCCATCCATGACATTGTGCAACTGGTG
GCCCGGGCGCTGGGCAGTGCGGCCCAGGTGCAGCCGAAGCGAGCCCTCCTCCCCGCCCCG
GTCAACTGCGGGGACCTGCAGCCGGCCGGGCCCGAGTCCCCGGGGCGCTTCTTGGCACGG
TTCCTGGCCAACACGTCCTTCCAGGGCCGCACGGGCCCCGTGTGGGTGACAGGCAGCTCC
CAGGTACACATGTCTCGGCACTTTAAGGTGTGGAGCCTTCGCCGGGACCCACGGGGCGCC
CCGGCCTGGGCCACGGTGGGCAGCTGGCGGGACGGCCAGCTGGACTTGGAACCGGGAGGT
GCCTCTGCACGGCCCCCGCCCCCACAGGGTGCCCAGGTCTGGCCCAAGCTGCGTGTGGTA
ACGCTGTTGGAACACCCATTTGTGTTTGCCCGTGATCCAGACGAAGACGGGCAGTGCCCA
GCGGGGCAGCTGTGCCTGGACCCTGGCACCAACGACTCGGCCACCCTGGACGCACTGTTC
GCCGCGCTGGCCAACGGCTCAGCGCCCCGTGCCCTGCGCAAGTGCTGCTACGGCTACTGC
ATTGACCTGCTGGAGCGGCTGGCGGAGGACACGCCCTTCGACTTCGAGCTGTACCTCGTG
GGTGACGGCAAGTACGGCGCCCTGCGGGACGGCCGCTGGACCGGCCTGGTCGGGGACCTG
CTGGCCGGCCGGGCCCACATGGCGGTCACCAGCTTCAGTATCAACTCCGCCCGCTCACAG
GTGGTGGACTTCACCAGCCCCTTCTTCTCCACCAGCCTGGGCATCATGGTGCGGGCACGG
GACACGGCCTCACCCATCGGTGCCTTTATGTGGCCCCTGCACTGGTCCACGTGGCTGGGC
GTCTTTGCGGCCCTGCACCTCACCGCGCTCTTCCTCACCGTGTACGAGTGGCGTAGCCCC
TACGGCCTCACGCCACGTGGCCGCAACCGCAGCACCGTCTTCTCCTACTCCTCAGCCCTC
AACCTGTGCTACGCCATCCTCTTCAGACGCACCGTGTCCAGCAAGACGCCCAAGTGCCCC
ACGGGCCGCCTGCTCATGAACCTCTGGGCCATCTTCTGCCTGCTGGTGCTGTCCAGCTAC
ACGGCCAACCTGGCTGCCGTCATGGTCGGGGACAAGACCTTCGAGGAGCTGTCGGGGATC
CACGACCCCAAGCTGCACCACCCGGCGCAGGGCTTCCGCTTCGGCACCGTGTGGGAGAGC
AGCGCCGAGGCGTACATCAAGAAGAGCTTCCCCGACATGCACGCACACATGCGGCGCCAC
AGCGCGCCCACCACGCCCCGCGGCGTCGCCATGCTCACGAGCGACCCCCCCAAGCTCAAC
GCCTTCATCATGGACAAGTCGCTCCTGGACTACGAGGTCTCCATCGACGCCGACTGCAAA
CTGCTGACCGTGGGAAAGCCCTTCGCCATTGAGGGCTATGGGATCGGACTGCCCCAGAAC
TCGCCGCTCACCTCCAACCTGTCCGAGTTCATCAGCCGCTACAAGTCCTCCGGCTTCATC
GACCTGCTCCACGACAAGTGGTACAAGATGGTGCCTTGCGGCAAGCGGGTCTTTGCGGTT
ACAGAGACCCTGCAGATGAGCATCTACCACTTCGCGGGCCTCTTCGTGTTGCTGTGCCTG
GGCCTGGGCAGCGCTCTGCTCAGCTCGCTGGGCGAGCACGCCTTCTTCCGCCTGGCGCTG
CCGCGCATCCGCAAGGGGAGCAGGCTGCAGTACTGGCTGCACACCAGCCAGAAAATCCAC
CGCGCCCTCAACACGGAGCCACCAGAGGGGTCGAAGGAGGAGACGGCAGAGGCGGAGCCC
AGCGGCCCCGAGGTGGAGCAGCAGCAGCAGCAGCAGGACCAGCCAACGGCTCCGGAGGGC
TGGAAACGGGCGCGCCGGGCCGTGGACAAGGAGCGCCGCGTGCGCTTCCTGCTGGAGCCC
GCCGTGGTTGTGGCACCCGAAGCGGACGCGGAGGCGGAGGCTGCGCCGCGAGAGGGCCCC
GTCTGGCTGTGCTCCTACGGCCGCCCGCCCGCCGCAAGGCCCACGGGGGCCCCCCAGCCC
GGGGAGCTGCAGGAGCTGGAGCGCCGCATCGAAGTCGCGCGTGAGCGGCTCCGCCAGGCC
CTGGTGCGGCGCGGCCAGCTCCTGGCACAGCTCGGGGACAGCGCACGTCACCGGCCTCGG
CGCTTGCTTCAGGCCAGAGCGGCCCCCGCGGAGGCCCCACCACACTCTGGCCGACCGGGG
AGCCAGGAATGA
Protein Properties
Number of Residues 1043
Molecular Weight 112991.0
Theoretical pI 9.5
Pfam Domain Function
Signals
  • 1-22
Transmembrane Regions
  • 565-585
  • 649-669
  • 831-851
Protein Sequence
>Glutamate [NMDA] receptor subunit 3B
MEFVRALWLGLALALGPGSAGGHPQPCGVLARLGGSVRLGALLPRAPLARARARAALARA
ALAPRLPHNLSLELVVAAPPARDPASLTRGLCQALVPPGVAALLAFPEARPELLQLHFLA
AATETPVLSLLRREARAPLGAPNPFHLQLHWASPLETLLDVLVAVLQAHAWEDVGLALCR
TQDPGGLVALWTSRAGRPPQLVLDLSRRDTGDAGLRARLAPMAAPVGGEAPVPAAVLLGC
DIARARRVLEAVPPGPHWLLGTPLPPKALPTAGLPPGLLALGEVARPPLEAAIHDIVQLV
ARALGSAAQVQPKRALLPAPVNCGDLQPAGPESPGRFLARFLANTSFQGRTGPVWVTGSS
QVHMSRHFKVWSLRRDPRGAPAWATVGSWRDGQLDLEPGGASARPPPPQGAQVWPKLRVV
TLLEHPFVFARDPDEDGQCPAGQLCLDPGTNDSATLDALFAALANGSAPRALRKCCYGYC
IDLLERLAEDTPFDFELYLVGDGKYGALRDGRWTGLVGDLLAGRAHMAVTSFSINSARSQ
VVDFTSPFFSTSLGIMVRARDTASPIGAFMWPLHWSTWLGVFAALHLTALFLTVYEWRSP
YGLTPRGRNRSTVFSYSSALNLCYAILFRRTVSSKTPKCPTGRLLMNLWAIFCLLVLSSY
TANLAAVMVGDKTFEELSGIHDPKLHHPAQGFRFGTVWESSAEAYIKKSFPDMHAHMRRH
SAPTTPRGVAMLTSDPPKLNAFIMDKSLLDYEVSIDADCKLLTVGKPFAIEGYGIGLPQN
SPLTSNLSEFISRYKSSGFIDLLHDKWYKMVPCGKRVFAVTETLQMSIYHFAGLFVLLCL
GLGSALLSSLGEHAFFRLALPRIRKGSRLQYWLHTSQKIHRALNTEPPEGSKEETAEAEP
SGPEVEQQQQQQDQPTAPEGWKRARRAVDKERRVRFLLEPAVVVAPEADAEAEAAPREGP
VWLCSYGRPPAARPTGAPQPGELQELERRIEVARERLRQALVRRGQLLAQLGDSARHRPR
RLLQARAAPAEAPPHSGRPGSQE
GenBank ID Protein 62988346
UniProtKB/Swiss-Prot ID O60391
UniProtKB/Swiss-Prot Entry Name NMD3B_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_138690.1
GeneCard ID GRIN3B
GenAtlas ID GRIN3B
HGNC ID HGNC:16768
References
General References
  1. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [PubMed:15057824 ]
  2. Andersson O, Stenqvist A, Attersand A, von Euler G: Nucleotide sequence, genomic organization, and chromosomal localization of genes encoding the human NMDA receptor subunits NR3A and NR3B. Genomics. 2001 Dec;78(3):178-84. [PubMed:11735224 ]
  3. Nishi M, Hinds H, Lu HP, Kawata M, Hayashi Y: Motoneuron-specific expression of NR3B, a novel NMDA-type glutamate receptor subunit that works in a dominant-negative manner. J Neurosci. 2001 Dec 1;21(23):RC185. [PubMed:11717388 ]
  4. Bendel O, Meijer B, Hurd Y, von Euler G: Cloning and expression of the human NMDA receptor subunit NR3B in the adult human hippocampus. Neurosci Lett. 2005 Mar 22;377(1):31-6. Epub 2004 Dec 15. [PubMed:15722182 ]