Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01645
Secondary Accession Numbers
  • 6970
Name Glutamate [NMDA] receptor subunit epsilon-4
Synonyms
  1. EB11
  2. N-methyl D-aspartate receptor subtype 2D
  3. NMDAR2D
  4. NR2D
Gene Name GRIN2D
Protein Type Unknown
Biological Properties
General Function Involved in ionotropic glutamate receptor activity
Specific Function NMDA receptor subtype of glutamate-gated ion channels with high calcium permeability and voltage-dependent sensitivity to magnesium. Mediated by glycine
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
periplasmic space
outer membrane-bounded periplasmic space
Function
receptor activity
transmembrane receptor activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
molecular transducer activity
signal transducer activity
transporter activity
ion channel activity
ligand-gated ion channel activity
extracellular ligand-gated ion channel activity
excitatory extracellular ligand-gated ion channel activity
extracellular-glutamate-gated ion channel activity
glutamate receptor activity
ionotropic glutamate receptor activity
Process
establishment of localization
transport
ion transport
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
  3. Multi-pass membrane protein
  4. Cell junction
  5. synapse
  6. postsynaptic cell membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 19q13.1-qter
SNPs GRIN2D
Gene Sequence
>4011 bp
ATGCGCGGCGCCGGTGGCCCCCGCGGCCCTCGGGGCCCCGCTAAGATGCTGCTGCTGCTG
GCGCTGGCCTGCGCCAGCCCGTTCCCGGAGGAGGCGCCGGGGCCGGGCGGGGCCGGTGGG
CCCGGCGGCGGCCTCGGCGGGGCGCGGCCGCTCAACGTGGCGCTCGTGTTCTCGGGGCCC
GCGTACGCGGCCGAGGCGGCACGCCTGGGCCCGGCCGTGGCGGCGGCGGTGCGCAGCCCG
GGCCTAGACGTGCGGCCCGTGGCGCTGGTGCTCAACGGCTCGGACCCGCGCAGCCTCGTG
CTGCAGCTCTGCGACCTGCTGTCGGGGTTGCGCGTGCACGGCGTGGTCTTCGAAGACGAC
TCGCGCGCGCCCGCCGTCGCGCCCATCCTCGACTTCCTGTCGGCGCAGACCTCGCTGCCC
ATCGTGGCCGTGCACGGCGGCGCCGCGCTCGTGCTCACGCCCAAGGAGAAGGGCTCCACC
TTCCTGCAGCTGGGCTCTTCCACCGAGCAACAGCTTCAGGTCATCTTTGAGGTGCTGGAG
GAGTATGACTGGACGTCCTTTGTAGCCGTGACCACTCGTGCCCCTGGCCACCGGGCCTTC
CTGTCCTACATTGAGGTGCTGACTGACGGTAGTCTGGTGGGCTGGGAGCACCGCGGAGCG
CTGACGCTGGACCCTGGGGCGGGCGAGGCCGTGCTCAGTGCCCAGCTCCGCAGTGTCAGC
GCGCAGATCCGCCTGCTCTTCTGCGCCCGAGAGGAGGCCGAGCCCGTGTTCCGCGCAGCT
GAGGAGGCTGGCCTCACTGGATCTGGCTACGTCTGGTTCATGGTGGGGCCCCAGCTGGCT
GGAGGCGGGGGCTCTGGGGCCCCTGGTGAGCCCCCTCTTCTGCCAGGAGGCGCCCCCCTG
CCTGCCGGGCTGTTTGCAGTGCGCTCGGCTGGCTGGCGGGATGACCTGGCTCGGCGAGTG
GCAGCTGGCGTGGCCGTAGTGGCCAGAGGTGCCCAGGCCCTGCTGCGTGATTATGGTTTC
CTTCCTGAGCTCGGCCACGACTGTCGCGCCCAGAACCGCACCCACCGCGGCGAGAGTCTG
CATAGGTACTTCATGAACATCACGTGGGATAACCGGGATTACTCCTTCAATGAGGACGGC
TTCCTAGTGAACCCCTCCCTGGTGGTCATCTCCCTCACCAGAGACAGGACGTGGGAGGTG
GTGGGCAGCTGGGAGCAGCAGACGCTCCGCCTCAAGTACCCGCTGTGGTCCCGCTATGGT
CGCTTCCTGCAGCCAGTGGACGACACGCAGCACCTCACGGTGGCCACGCTGGAGGAAAGG
CCGTTTGTCATCGTGGAGCCTGCAGACCCTATCAGCGGCACCTGCATCCGAGACTCCGTC
CCCTGCCGGAGCCAGCTCAACCGAACCCACAGCCCTCCACCGGATGCCCCCCGCCCGGAA
AAGCGCTGCTGCAAGGGTTTCTGCATCGACATTCTGAAGCGGCTGGCGCATACCATCGGC
TTCAGCTACGACCTCTACCTGGTCACCAATGGCAAGCACGGAAAGAAGATCGATGGCGTC
TGGAACGGCATGATCGGGGAGGTGTTCTACCAGCGCGCAGACATGGCCATCGGCTCCCTC
ACCATCAACGAGGAGCGCTCCGAGATCGTGGACTTCTCCGTCCCCTTCGTGGAGACCGGC
ATCAGCGTCATGGTGGCGCGCAGCAATGGCACGGTGTCCCCCTCGGCCTTCCTCGAGCCC
TACAGCCCCGCCGTGTGGGTGATGATGTTCGTCATGTGCCTCACTGTGGTCGCCGTCACT
GTTTTCATCTTCGAGTACCTCAGTCCTGTTGGTTACAACCGCAGCCTGGCCACGGGCAAG
CGCCCTGGCGGTTCAACCTTCACCATTGGGAAATCCATCTGGCTGCTCTGGGCCCTGGTG
TTCAATAATTCGGTGCCCGTGGAGAACCCCCGGGGAACCACCAGCAAAATCATGGTGCTG
GTGTGGGCCTTCTTCGCCGTCATCTTCCTCGCCAGCTACACAGCCAACCTGGCCGCCTTC
ATGATCCAGGAGGAGTACGTGGATACTGTGTCTGGGCTCAGTGACCGCAAGTTCCAGAGG
CCCCAGGAGCAGTACCCGCCCCTGAAGTTTGGGACCGTGCCCAACGGCTCCACGGAGAAG
AACATCCGCAGCAACTATCCCGACATGCACAGCTACATGGTGCGCTACAACCAGCCCCGC
GTAGAGGAAGCGCTCACTCAGCTCAAGGCAGGGAAGCTGGACGCCTTCATCTACGATGCT
GCAGTGCTCAATTACATGGCCCGCAAGGACGAGGGCTGCAAGCTTGTCACCATCGGCTCC
GGCAAGGTCTTCGCCACGACAGGCTATGGCATCGCCCTGCACAAGGGCTCCCGCTGGAAG
CGGCCCATCGACCTGGCGTTGCTGCAGTTCCTGGGGGATGATGAGATCGAGATGCTGGAG
CGGCTGTGGCTCTCTGGGATCTGCCACAATGACAAAATCGAGGTGATGAGCAGCAAGCTG
GACATCGACAACATGGCGGGCGTCTTCTACATGCTCCTGGTGGCCATGGGCCTGTCCCTG
CTGGTCTTCGCCTGGGAGCACCTGGTGTACTGGCGCCTGCGGCACTGCCTGGGGCCCACC
CACCGCATGGACTTCCTGCTGGCCTTCTCCAGGGGCATGTACAGCTGCTGCAGCGCTGAG
GCCGCCCCACCGCCCGCCAAGCCCCCGCCGCCGCCACAGCCCCTGCCCAGCCCCGCGTAC
CCCGCGCCGCGGCCGGCTCCCGGGCCCGCACCTTTCGTGCCCCGCGAGCGCGCCTCAGTG
GACCGCTGGCGCCGGACCAAGGGCGCGGGGCCGCCGGGGGGCGCGGGCCTGGCCGACGGC
TTCCACCGCTACTACGGCCCCATCGAGCCGCAGGGCCTAGGCCTCGGCCTGGGCGAAGCG
CGCGCGGCACCGCGGGGCGCAGCCGGGCGCCCGCTGTCCCCGCCGGCCGCTCAGCCCCCG
CAGAAGCCGCCGCCCTCCTATTTCGCCATCGTACGCGACAAGGAGCCAGCCGAGCCCCCC
GCCGGCGCCTTCCCCGGCTTCCCGTCGCCGCCCGCGCCCCCCGCCGCCGCGGCCACCGCC
GTCGGGCCGCCACTCTGCCGCTTGGCCTTCGAGGACGAGAGCCCGCCGGCGCCCGCGCGG
TGGCCGCGCTCGGACCCCGAGAGCCAACCCCTGCTGGGGCCAGGCGCGGGCGGCGCGGGG
GGCACGGGGGGCGCAGGCGGAGGAGCCCCGGCCGCTCCGCCCCCGTGCCGCGCCGCGCCG
CCCCCGTGCCCTTACCTCGATCTCGAGCCGTCGCCGTCGGACTCGGAGGACTCGGAGAGC
CTGGGCGGCGCGTCGCTGGGCGGCCTGGAGCCCTGGTGGTTCGCCGACTTCCCTTACCCG
TATGCCGAGCGCCTCGGGCCGCCGCCCGGCCGCTACTGGTCGGTCGACAAGCTCGGGGGC
TGGCGCGCCGGGAGCTGGGACTACCTGCCCCCGCGCAGCGGTCCGGCCGCCTGGCACTGT
CGGCACTGCGCCAGCCTGGAGCTGCTGCCGCCGCCGCGCCATCTCAGCTGCTCGCACGAT
GGCCTGGACGGCGGCTGGTGGGCGCCACCGCCTCCACCCTGGGCCGCCGGGCCCCTGCCC
CGACGCCGGGCCCGCTGCGGGTGCCCGCGGTCGCACCCGCACCGCCCGCGGGCCTCGCAC
CGCACGCCCGCCGCCGCCGCGCCCCACCACCACAGGCACCGGCGCGCCGCTGGGGGCTGG
GACCTCCCGCCGCCCGCGCCCACCTCGCGCTCGCTCGAGGACCTCAGCTCGTGCCCTCGC
GCCGCCCCTGCGCGCAGGCTTACCGGGCCCTCCCGCCACGCTCGCAGGTGTCCGCACGCC
GCGCACTGGGGGCCGCCGCTGCCCACAGCTTCCCACCGGAGACACCGGGGCGGGGACCTG
GGCACCCGCAGGGGCTCGGCGCACTTCTCTAGCCTCGAGTCCGAGGTATGA
Protein Properties
Number of Residues 1336
Molecular Weight 143750.7
Theoretical pI 8.41
Pfam Domain Function
Signals
  • 1-27
Transmembrane Regions
  • 584-604
  • 657-677
  • 845-865
Protein Sequence
>Glutamate [NMDA] receptor subunit epsilon-4
MRGAGGPRGPRGPAKMLLLLALACASPFPEEAPGPGGAGGPGGGLGGARPLNVALVFSGP
AYAAEAARLGPAVAAAVRSPGLDVRPVALVLNGSDPRSLVLQLCDLLSGLRVHGVVFEDD
SRAPAVAPILDFLSAQTSLPIVAVHGGAALVLTPKEKGSTFLQLGSSTEQQLQVIFEVLE
EYDWTSFVAVTTRAPGHRAFLSYIEVLTDGSLVGWEHRGALTLDPGAGEAVLSAQLRSVS
AQIRLLFCAREEAEPVFRAAEEAGLTGSGYVWFMVGPQLAGGGGSGAPGEPPLLPGGAPL
PAGLFAVRSAGWRDDLARRVAAGVAVVARGAQALLRDYGFLPELGHDCRAQNRTHRGESL
HRYFMNITWDNRDYSFNEDGFLVNPSLVVISLTRDRTWEVVGSWEQQTLRLKYPLWSRYG
RFLQPVDDTQHLTVATLEERPFVIVEPADPISGTCIRDSVPCRSQLNRTHSPPPDAPRPE
KRCCKGFCIDILKRLAHTIGFSYDLYLVTNGKHGKKIDGVWNGMIGEVFYQRADMAIGSL
TINEERSEIVDFSVPFVETGISVMVARSNGTVSPSAFLEPYSPAVWVMMFVMCLTVVAVT
VFIFEYLSPVGYNRSLATGKRPGGSTFTIGKSIWLLWALVFNNSVPVENPRGTTSKIMVL
VWAFFAVIFLASYTANLAAFMIQEEYVDTVSGLSDRKFQRPQEQYPPLKFGTVPNGSTEK
NIRSNYPDMHSYMVRYNQPRVEEALTQLKAGKLDAFIYDAAVLNYMARKDEGCKLVTIGS
GKVFATTGYGIALHKGSRWKRPIDLALLQFLGDDEIEMLERLWLSGICHNDKIEVMSSKL
DIDNMAGVFYMLLVAMGLSLLVFAWEHLVYWRLRHCLGPTHRMDFLLAFSRGMYSCCSAE
AAPPPAKPPPPPQPLPSPAYPAPRPAPGPAPFVPRERASVDRWRRTKGAGPPGGAGLADG
FHRYYGPIEPQGLGLGLGEARAAPRGAAGRPLSPPAAQPPQKPPPSYFAIVRDKEPAEPP
AGAFPGFPSPPAPPAAAATAVGPPLCRLAFEDESPPAPARWPRSDPESQPLLGPGAGGAG
GTGGAGGGAPAAPPPCRAAPPPCPYLDLEPSPSDSEDSESLGGASLGGLEPWWFADFPYP
YAERLGPPPGRYWSVDKLGGWRAGSWDYLPPRSGPAAWHCRHCASLELLPPPRHLSCSHD
GLDGGWWAPPPPPWAAGPLPRRRARCGCPRSHPHRPRASHRTPAAAAPHHHRHRRAAGGW
DLPPPAPTSRSLEDLSSCPRAAPARRLTGPSRHARRCPHAAHWGPPLPTASHRRHRGGDL
GTRRGSAHFSSLESEV
GenBank ID Protein 153946391
UniProtKB/Swiss-Prot ID O15399
UniProtKB/Swiss-Prot Entry Name NMDE4_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_000836.2
GeneCard ID GRIN2D
GenAtlas ID GRIN2D
HGNC ID HGNC:4588
References
General References
  1. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  2. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [PubMed:15057824 ]
  3. Hess SD, Daggett LP, Deal C, Lu CC, Johnson EC, Velicelebi G: Functional characterization of human N-methyl-D-aspartate subtype 1A/2D receptors. J Neurochem. 1998 Mar;70(3):1269-79. [PubMed:9489750 ]