Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01736
Secondary Accession Numbers
  • 7085
Name Ubiquinone biosynthesis protein COQ7 homolog
Synonyms
  1. Coenzyme Q biosynthesis protein 7 homolog
  2. Timing protein clk-1 homolog
Gene Name COQ7
Protein Type Unknown
Biological Properties
General Function Involved in oxidoreductase activity
Specific Function Involved in lifespan determination in ubiquinone-independent manner. Involved in ubiquinone biosynthesis. Potential central metabolic regulator (By similarity).
Pathways
  • Ubiquinone and other terpenoid-quinone biosynthesis
  • ubiquinone biosynthesis
  • Ubiquinone Biosynthesis
Reactions
2-Hexaprenyl-3-methyl-6-methoxy-1,4 benzoquinone + Oxygen + NADPH + Hydrogen Ion → 2-Hexaprenyl-3-methyl-5-hydroxy-6-methoxy-1,4-benzoquinone + NADP + Water details
2-Polyprenyl-3-methyl-6-methoxy-1,4-benzoquinone + Oxygen + NADPH + Hydrogen Ion → 2-Polyprenyl-3-methyl-5-hydroxy-6-methoxy-1,4-benzoquinone + NADP + Water details
GO Classification
Biological Process
ubiquinone biosynthetic process
age-dependent response to oxidative stress
determination of adult lifespan
mitochondrial ATP synthesis coupled electron transport
mitochondrion morphogenesis
neural tube formation
neurogenesis
in utero embryonic development
response to drug
cellular response to oxidative stress
Cellular Component
nucleus
mitochondrial inner membrane
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
transition metal ion binding
oxidoreductase activity
Molecular Function
transition metal ion binding
oxidoreductase activity
Process
metabolic process
macromolecule metabolic process
cellular metabolic process
oxidoreduction coenzyme metabolic process
ubiquinone metabolic process
ubiquinone biosynthetic process
oxidation reduction
cofactor metabolic process
coenzyme metabolic process
protein metabolic process
Cellular Location
  1. Peripheral membrane protein
  2. Mitochondrion inner membrane
  3. Matrix side
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs COQ7
Gene Sequence
>654 bp
ATGAGTTGCGCCGGGGCGGCGGCGGCTCCCCGCCTTTGGCGGCTGCGCCCGGGGGCCCGG
CGGTCCCTCTCAGCTTATGGAAGAAGAACCAGTGTCAGATTTCGCAGTTCAGGAATGACT
TTAGACAATATCAGTCGGGCAGCTGTGGATCGAATAATCCGGGTGGATCATGCAGGCGAA
TATGGAGCAAACCGCATCTATGCCGGGCAGATGGCTGTCCTGGGTCGGACCAGCGTCGGG
CCAGTCATTCAGAAAATGTGGGATCAAGAAAAGGACCATTTGAAAAAGTTCAATGAGTTG
ATGGTTACGTTCAGGGTCCGGCCAACAGTTCTGATGCCCTTGTGGAACGTGCTGGGGTTT
GCACTGGGGGCGGGGACCGCCTTGCTCGGGAAGGAAGGTGCCATGGCCTGCACCGTGGCG
GTGGAAGAGAGCATAGCACATCACTACAACAACCAGATCAGGACGCTGATGGAGGAGGAC
CCTGAAAAATACGAGGAACTTCTTCAGCTGATAAAGAAATTTCGGGATGAAGAGCTTGAG
CACCATGACATAGGCCTCGACCATGATGCAGAATTGGCTCCAGCCTATGCCGTCCTGAAG
AGCATTATCCAGGCCGGATGCAGAGTGGCGATATATTTATCAGAAAGATTATAA
Protein Properties
Number of Residues 217
Molecular Weight Not Available
Theoretical pI Not Available
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Ubiquinone biosynthesis protein COQ7 homolog
MSCAGAAAAPRLWRLRPGARRSLSAYGRRTSVRFRSSGMTLDNISRAAVDRIIRVDHAGE
YGANRIYAGQMAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVMFRVRPTVLMPLWNVLGF
ALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFRDEELE
HHDIGLDHDAELAPAYAVLKSIIQAGCRVAIYLSERL
GenBank ID Protein 25453484
UniProtKB/Swiss-Prot ID Q99807
UniProtKB/Swiss-Prot Entry Name COQ7_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_016138.4
GeneCard ID COQ7
GenAtlas ID COQ7
HGNC ID HGNC:2244
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Wiemann S, Weil B, Wellenreuther R, Gassenhuber J, Glassl S, Ansorge W, Bocher M, Blocker H, Bauersachs S, Blum H, Lauber J, Dusterhoft A, Beyer A, Kohrer K, Strack N, Mewes HW, Ottenwalder B, Obermaier B, Tampe J, Heubner D, Wambutt R, Korn B, Klein M, Poustka A: Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs. Genome Res. 2001 Mar;11(3):422-35. [PubMed:11230166 ]
  4. Asaumi S, Kuroyanagi H, Seki N, Shirasawa T: Orthologues of the Caenorhabditis elegans longevity gene clk-1 in mouse and human. Genomics. 1999 Jun 15;58(3):293-301. [PubMed:10373327 ]
  5. Vajo Z, King LM, Jonassen T, Wilkin DJ, Ho N, Munnich A, Clarke CF, Francomano CA: Conservation of the Caenorhabditis elegans timing gene clk-1 from yeast to human: a gene required for ubiquinone biosynthesis with potential implications for aging. Mamm Genome. 1999 Oct;10(10):1000-4. [PubMed:10501970 ]
  6. Ewbank JJ, Barnes TM, Lakowski B, Lussier M, Bussey H, Hekimi S: Structural and functional conservation of the Caenorhabditis elegans timing gene clk-1. Science. 1997 Feb 14;275(5302):980-3. [PubMed:9020081 ]