You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01751
Secondary Accession Numbers
  • 7102
Name Perilipin-3
Synonyms
  1. 47 kDa MPR-binding protein
  2. 47 kDa mannose 6-phosphate receptor-binding protein
  3. Cargo selection protein TIP47
  4. Mannose-6-phosphate receptor-binding protein 1
  5. PP17
  6. Placental protein 17
Gene Name PLIN3
Protein Type Enzyme
Biological Properties
General Function Involved in protein binding
Specific Function Required for the transport of mannose 6-phosphate receptors (MPR) from endosomes to the trans-Golgi network
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Cytoplasm
  2. Peripheral membrane protein
  3. Endosome membrane
  4. Cytoplasmic side (Potential)
  5. Lipid droplet (Potential)
Gene Properties
Chromosome Location Chromosome:1
Locus 19p13.3
SNPs PLIN3
Gene Sequence
>1305 bp
ATGTCTGCCGACGGGGCAGAGGCTGATGGCAGCACCCAGGTGACAGTGGAAGAACCGGTA
CAGCAGCCCAGTGTGGTGGACCGTGTGGCCAGCATGCCTCTGATCAGCTCCACCTGCGAC
ATGGTGTCCGCAGCCTATGCCTCCACCAAGGAGAGCTACCCGCACATCAAGACTGTCTGC
GACGCAGCAGAGAAGGGAGTGAGGACCCTCACGGCGGCTGCTGTCAGCGGGGCTCAGCCG
ATCCTCTCCAAGCTGGAGCCCCAGATTGCATCAGCCAGCGAATACGCCCACAGGGGGCTG
GACAAGTTGGAGGAGAACCTCCCCATCCTGCAGCAGCCCACGGAGAAGGTCCTGGCGGAC
ACCAAGGAGCTTGTGTCGTCTAAGGTGTCGGGGGCCCAAGAGATGGTGTCTAGCGCCAAG
GACACGGTGGCCACCCAATTGTCGGAGGCGGTGGACGCGACCCGCGGTGCTGTGCAGAGC
GGCGTGGACAAGACAAAGTCCGTAGTGACCGGCGGCGTCCAATCGGTCATGGGCTCCCGC
TTGGGCCAGATGGTGTTGAGTGGGGTCGACACGGTGCTGGGGAAGTCGGAGGAGTGGGCG
GACAACCACCTGCCCCTTACGGATGCCGAACTGGCCCGCATCGCCACATCCCTGGATGGC
TTTGACGTCGCGTCCGTGCAGCAGCAGCGGCAGGAACAGAGCTACTTCGTACGTCTGGGC
TCCCTGTCGGAGAGGCTGCGGCAGCACGCCTATGAGCACTCGCTGGGCAAGCTTCGAGCC
ACCAAGCAGAGGGCACAGGAGGCTCTGCTGCAGCTGTCGCAGGTCCTAAGCCTGATGGAA
ACTGTCAAGCAAGGCGTTGATCAGAAGCTGGTGGAAGGCCAGGAGAAGCTGCACCAGATG
TGGCTCAGCTGGAACCAGAAGCAGCTCCAGGGCCCCGAGAAGGAGCCGCCCAAGCCAGAG
CAGGTCGAGTCCCGGGCGCTCACCATGTTCCGGGACATTGCCCAGCAACTGCAGGCCACC
TGTACCTCCCTGGGGTCCAGCATTCAGGGCCTCCCCACCAATGTGAAGGACCAGGTGCAG
CAGGCCCGCCGCCAGGTGGAGGACCTCCAGGCCACGTTTTCCAGCATCCACTCCTTCCAG
GACCTGTCCAGCAGCATTCTGGCCCAGAGCCGTGAGCGTGTCGCCAGCGCCCGCGAGGCC
CTGGACCACATGGTGGAATATGTGGCCCAGAACACACCTGTCACGTGGCTCGTGGGACCC
TTTGCCCCTGGAATCACTGAGAAAGCCCCGGAGGAGAAGAAGTAG
Protein Properties
Number of Residues 434
Molecular Weight 47046.6
Theoretical pI 5.11
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Perilipin-3
MSADGAEADGSTQVTVEEPVQQPSVVDRVASMPLISSTCDMVSAAYASTKESYPHIKTVC
DAAEKGVRTLTAAAVSGAQPILSKLEPQIASASEYAHRGLDKLEENLPILQQPTEKVLAD
TKELVSSKVSGAQEMVSSAKDTVATQLSEAVDATRGAVQSGVDKTKSVVTGGVQSVMGSR
LGQMVLSGVDTVLGKSEEWADNHLPLTDAELARIATSLDGFDVASVQQQRQEQSYFVRLG
SLSERLRQHAYEHSLGKLRATKQRAQEALLQLSQALSLMETVKQGVDQKLVEGQEKLHQM
WLSWNQKQLQGPEKEPPKPEQVESRALTMFRDIAQQLQATCTSLGSSIQGLPTNVKDQVQ
QARRQVEDLQATFSSIHSFQDLSSSILAQSRERVASAREALDHMVEYVAQNTPVTWLVGP
FAPGITEKAPEEKK
GenBank ID Protein 255958282
UniProtKB/Swiss-Prot ID O60664
UniProtKB/Swiss-Prot Entry Name PLIN3_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_005817.4
GeneCard ID PLIN3
GenAtlas ID Not Available
HGNC ID Not Available
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  4. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  5. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  6. Bohn H, Kraus W, Winckler W: Purification and characterization of two new soluble placental tissue proteins (PP13 and PP17). Oncodev Biol Med. 1983;4(5):343-50. [PubMed:6856484 ]
  7. Diaz E, Pfeffer SR: TIP47: a cargo selection device for mannose 6-phosphate receptor trafficking. Cell. 1998 May 1;93(3):433-43. [PubMed:9590177 ]
  8. Than NG, Sumegi B, Than GN, Kispal G, Bohn H: Cloning and sequence analysis of cDNAs encoding human placental tissue protein 17 (PP17) variants. Eur J Biochem. 1998 Dec 1;258(2):752-7. [PubMed:9874244 ]
  9. Than NG, Sumegi B, Than GN, Kispal G, Bohn H: Cloning and sequencing of human oncodevelopmental soluble placental tissue protein 17 (PP17): homology with adipophilin and the mouse adipose differentiation-related protein. Tumour Biol. 1999 Jul-Aug;20(4):184-92. [PubMed:10393528 ]
  10. Robenek H, Lorkowski S, Schnoor M, Troyer D: Spatial integration of TIP47 and adipophilin in macrophage lipid bodies. J Biol Chem. 2005 Feb 18;280(7):5789-94. Epub 2004 Nov 15. [PubMed:15545278 ]