You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01765
Secondary Accession Numbers
  • 7118
Name Cytochrome c-type heme lyase
Synonyms
  1. CCHL
  2. Holocytochrome c-type synthase
Gene Name HCCS
Protein Type Unknown
Biological Properties
General Function Involved in holocytochrome-c synthase activity
Specific Function Links covalently the heme group to the apoprotein of cytochrome c (By similarity).
Pathways
  • Porphyrin and chlorophyll metabolism
Reactions
Holocytochrome c → apocytochrome c + Heme details
Cytochrome c → Apocytochrome c + Heme details
GO Classification
Biological Process
organ morphogenesis
oxidation-reduction process
Cellular Component
mitochondrial inner membrane
Component
mitochondrion
organelle
membrane-bounded organelle
intracellular membrane-bounded organelle
Function
carbon-sulfur lyase activity
catalytic activity
lyase activity
holocytochrome-c synthase activity
Molecular Function
holocytochrome-c synthase activity
metal ion binding
Cellular Location
  1. Mitochondrion inner membrane (Potential)
Gene Properties
Chromosome Location X
Locus Xp22.3
SNPs HCCS
Gene Sequence
>807 bp
ATGGGTTTGTCTCCATCTGCTCCTGCTGTTGCAGTTCAGGCCTCAAATGCTTCAGCGTCC
CCACCTTCAGGATGCCCGATGCATGAAGGGAAAATGAAAGGCTGTCCAGTGAATACAGAG
CCATCTGGCCCAACCTGTGAGAAGAAAACATACTCTGTGCCTGCCCACCAGGAACGCGCC
TATGAGTACGTGGAGTGTCCCATTAGGGGCACTGCGGCTGAGAATAAGGAGAACCTAGAT
CCTTCAAATCTGATGCCACCACCAAATCAAACACCAGCTCCAGATCAGCCATTTGCATTG
TCTACTGTCAGAGAAGAGTCATCCATTCCGAGAGCAGATTCAGAGAAAAAGTGGGTTTAC
CCTTCTGAGCAGATGTTCTGGAATGCAATGTTAAAGAAAGGGTGGAAGTGGAAGGATGAG
GATATCAGTCAGAAGGATATGTATAATATCATTAGAATTCACAATCAGAATAACGAGCAG
GCTTGGAAGGAGATTTTGAAGTGGGAAGCCCTTCATGCTGCAGAGTGTCCTTGTGGTCCA
TCATTGATCCGGTTTGGAGGGAAAGCAAAAGAGTATTCACCAAGGGCACGAATTCGTTCC
TGGATGGGGTATGAGTTGCCTTTTGATAGGCACGATTGGATCATAAACCGTTGCGGGACA
GAAGTTAGATATGTGATTGATTATTATGATGGTGGTGAAGTCAACAAGGACTACCAGTTC
ACCATCCTGGACGTCCGTCCTGCCTTAGATTCACTTTCGGCAGTATGGGACAGAATGAAA
GTCGCTTGGTGGCGTTGGACCTCGTAA
Protein Properties
Number of Residues 268
Molecular Weight 30601.335
Theoretical pI 6.682
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Cytochrome c-type heme lyase
MGLSPSAPAVAVQASNASASPPSGCPMHEGKMKGCPVNTEPSGPTCEKKTYSVPAHQERA
YEYVECPIRGTAAENKENLDPSNLMPPPNQTPAPDQPFALSTVREESSIPRADSEKKWVY
PSEQMFWNAMLKKGWKWKDEDISQKDMYNIIRIHNQNNEQAWKEILKWEALHAAECPCGP
SLIRFGGKAKEYSPRARIRSWMGYELPFDRHDWIINRCGTEVRYVIDYYDGGEVNKDYQF
TILDVRPALDSLSAVWDRMKVAWWRWTS
GenBank ID Protein 3582744
UniProtKB/Swiss-Prot ID P53701
UniProtKB/Swiss-Prot Entry Name CCHL_HUMAN
PDB IDs Not Available
GenBank Gene ID AF053015
GeneCard ID HCCS
GenAtlas ID HCCS
HGNC ID HGNC:4837
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Schaefer L, Ballabio A, Zoghbi HY: Cloning and characterization of a putative human holocytochrome c-type synthetase gene (HCCS) isolated from the critical region for microphthalmia with linear skin defects (MLS). Genomics. 1996 Jun 1;34(2):166-72. [PubMed:8661044 ]
  4. Van den Veyver IB, Subramanian S, Zoghbi HY: Genomic structure of a human holocytochrome c-type synthetase gene in Xp22.3 and mutation analysis in patients with Rett syndrome. Am J Med Genet. 1998 Jun 30;78(2):179-81. [PubMed:9674913 ]
  5. Wimplinger I, Morleo M, Rosenberger G, Iaconis D, Orth U, Meinecke P, Lerer I, Ballabio A, Gal A, Franco B, Kutsche K: Mutations of the mitochondrial holocytochrome c-type synthase in X-linked dominant microphthalmia with linear skin defects syndrome. Am J Hum Genet. 2006 Nov;79(5):878-89. Epub 2006 Sep 6. [PubMed:17033964 ]