Hmdb loader
Survey

Showing Protein Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2 (HMDBP01767)

IdentificationBiological propertiesGene propertiesProtein propertiesExternal linksReferencesXMLShow 4 metabolites
Identification
HMDB Protein ID HMDBP01767
Secondary Accession Numbers
  • 7120
Name Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2
Synonyms
  1. G gamma-I
Gene Name GNG2
Protein Type Unknown
Biological Properties
General Function Involved in signal transducer activity
Specific Function Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein- effector interaction
Pathways
  • Acrivastine H1-Antihistamine Action
  • Alcaftadine H1-Antihistamine Action
  • Alimemazine H1-Antihistamine Action
  • Antazoline H1-Antihistamine Action
  • Astemizole H1-Antihistamine Action
  • Azatadine H1-Antihistamine Action
  • Azelastine H1-Antihistamine Action
  • Bamipine H1-Antihistamine Action
  • Bepotastine H1-Antihistamine Action
  • Betahistine H1-Antihistamine Action
  • Bilastine H1-Antihistamine Action
  • Bromodiphenhydramine H1-Antihistamine Action
  • Brompheniramine H1-Antihistamine Action
  • Buclizine H1-Antihistamine Action
  • Carbinoxamine H1-Antihistamine Action
  • Cetirizine H1-Antihistamine Action
  • Chlorcyclizine H1-Antihistamine Action
  • Chloropyramine H1-Antihistamine Action
  • Chlorphenamine H1-Antihistamine Action
  • Chlorphenoxamine H1-Antihistamine Action
  • Cinnarizine H1-Antihistamine Action
  • Clemastine H1-Antihistamine Action
  • Clocinizine H1-Antihistamine Action
  • Cyclizine H1-Antihistamine Action
  • Cyproheptadine H1-Antihistamine Action
  • Deptropine H1-Antihistamine Action
  • Desloratadine H1-Antihistamine Action
  • Dexbrompheniramine H1-Antihistamine Action
  • Dexchlorpheniramine H1-Antihistamine Action
  • Dimetindene H1-Antihistamine Action
  • Diphenhydramine H1-Antihistamine Action
  • Diphenylpyraline H1-Antihistamine Action
  • Doxepin H1-Antihistamine Action
  • Doxylamine H1-Antihistamine Action
  • Ebastine H1-Antihistamine Action
  • Embramine H1-Antihistamine Action
  • Emedastine H1-Antihistamine Action
  • Epinastine H1-Antihistamine Action
  • Fenethazine H1-Antihistamine Action
  • Fexofenadine H1-Antihistamine Action
  • Flunarizine H1-Antihistamine Action
  • Histamine H1 Receptor Activation
  • Histapyrrodine H1-Antihistamine Action
  • Homochlorcyclizine H1-Antihistamine Action
  • Hydroxyethylpromethazine H1-Antihistamine Action
  • Hydroxyzine H1-Antihistamine Action
  • Isothipendyl H1-Antihistamine Action
  • Ketotifen H1-Antihistamine Action
  • Latrepirdine H1-Antihistamine Action
  • Levocabastine H1-Antihistamine Action
  • Levocetirizine H1-Antihistamine Action
  • Loratadine H1-Antihistamine Action
  • Lysophosphatidic Acid LPA1 Signalling
  • Lysophosphatidic Acid LPA2 Signalling
  • Lysophosphatidic Acid LPA3 Signalling
  • Lysophosphatidic Acid LPA4 Signalling
  • Lysophosphatidic Acid LPA5 Signalling
  • Lysophosphatidic Acid LPA6 Signalling
  • Mebhydrolin H1-Antihistamine Action
  • Meclizine H1-Antihistamine Action
  • Mepyramine H1-Antihistamine Action
  • Mequitazine H1-Antihistamine Action
  • Methapyrilene H1-Antihistamine Action
  • Methdilazine H1-Antihistamine Action
  • Mirtazapine H1-Antihistamine Action
  • Mizolastine H1-Antihistamine Action
  • Olopatadine H1-Antihistamine Action
  • Orphenadrine H1-Antihistamine Action
  • Oxatomide H1-Antihistamine Action
  • Oxomemazine H1-Antihistamine Action
  • Phenbenzamine H1-Antihistamine Action
  • Phenindamine H1-Antihistamine Action
  • Pheniramine H1-Antihistamine Action
  • Phenyltoloxamine H1-Antihistamine Action
  • Pimethixene H1-Antihistamine Action
  • Promethazine H1-Antihistamine Action
  • Propiomazine H1-Antihistamine Action
  • Pyrrobutamine H1-Antihistamine Action
  • Quetiapine H1-Antihistamine Action
  • Quifenadine H1-Antihistamine Action
  • Rupatadine H1-Antihistamine Action
  • Talastine H1-Antihistamine Action
  • Temelastine H1-Antihistamine Action
  • Terfenadine H1-Antihistamine Action
  • Thenalidine H1-Antihistamine Action
  • Thenyldiamine H1-Antihistamine Action
  • Thiazinamium H1-Antihistamine Action
  • Thonzylamine H1-Antihistamine Action
  • Tolpropamine H1-Antihistamine Action
  • Tripelennamine H1-Antihistamine Action
  • Triprolidine H1-Antihistamine Action
  • Tritoqualine H1-Antihistamine Action
Reactions Not Available
GO Classification
Component
cell part
membrane part
extrinsic to membrane
extrinsic to plasma membrane
heterotrimeric g-protein complex
Function
molecular transducer activity
signal transducer activity
Process
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location
  1. Cell membrane
  2. Lipid-anchor
  3. Cytoplasmic side (Potential)
Gene Properties
Chromosome Location Chromosome:1
Locus 14q21
SNPs GNG2
Gene Sequence 
>216 bp
ATGGCCAGCAACAACACCGCCAGCATAGCACAAGCCAGGAAGCTGGTAGAGCAGCTTAAG
ATGGAAGCCAATATCGACAGGATAAAGGTGTCCAAGGCAGCTGCAGATTTGATGGCCTAC
TGTGAAGCACATGCCAAGGAAGACCCCCTCCTGACCCCTGTTCCGGCTTCAGAAAACCCG
TTTAGGGAGAAGAAGTTTTTCTGTGCCATCCTTTAA
Protein Properties
Number of Residues 71
Molecular Weight 7850.0
Theoretical pI 8.22
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence 
>Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2
MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENP
FREKKFFCAIL
GenBank ID Protein 20147633
UniProtKB/Swiss-Prot ID P59768
UniProtKB/Swiss-Prot Entry Name GBG2_HUMAN
PDB IDs
GenBank Gene ID AF493870
GeneCard ID GNG2
GenAtlas ID GNG2
HGNC ID HGNC:4404
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  3. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  4. Modarressi MH, Taylor KE, Wolfe J: Cloning, characterization, and mapping of the gene encoding the human G protein gamma 2 subunit. Biochem Biophys Res Commun. 2000 Jun 7;272(2):610-5. [PubMed:10833460 ]