Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01779
Secondary Accession Numbers
  • 7132
Name Rap1 GTPase-GDP dissociation stimulator 1
Synonyms
  1. Exchange factor smgGDS
  2. SMG GDS protein
  3. SMG P21 stimulatory GDP/GTP exchange protein
Gene Name RAP1GDS1
Protein Type Unknown
Biological Properties
General Function Involved in binding
Specific Function Stimulates GDP/GTP exchange reaction of a group of small GTP-binding proteins (G proteins) including Rap1a/Rap1b, RhoA, RhoB and KRas, by stimulating the dissociation of GDP from and the subsequent binding of GTP to each small G protein
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:4
Locus 4q23-q25
SNPs RAP1GDS1
Gene Sequence
>1824 bp
ATGGATAATCTCAGTGATACCTTGAAGAAGCTGAAGATAACAGCTGTTGACAAGACTGAG
GATAGTTTAGAAGGATGCTTGGATTGTCTGCTTCAAGCCCTGGCTCAAAATAATACGGAA
ACAAGTGAAAAAATCCAAGCAAGTGGAATACTTCAGCTGTTTGCAAGTCTGTTGACTCCA
CAGTCTTCCTGCAAAGCCAAAGTAGCTAACATCATAGCAGAAGTAGCCAAAAATGAGTTT
ATGCGAATTCCATGTGTGGATGCTGGATTGATTTCACCACTGGTGCAGCTGCTAAATAGC
AAAGACCAGGAAGTGCTGCTTCAAACGGGCAGGGCTCTAGGAAACATATGTTACGATAGC
CATGAGGGCAGAAGTGCAGTTGACCAAGCAGGTGGTGCACAGATTGTAATTGACCATTTA
AGGTCACTGTGCAGTATAACAGATCCCGCCAATGAGAAGCTCTTGACTGTCTTTTGTGGC
ATGCTGATGAACTATAGCAATGAGAATGATTCGCTTCAAGCTCAGCTTATCAATATGGGT
GTTATTCCTACCTTAGTGAAATTACTGGGCATCCACTGCCAAAATGCAGCTCTTACAGAA
ATGTGTCTTGTTGCATTTGGTAATTTAGCAGAACTTGAGTCAAGTAAAGAACAGTTTGCC
AGTACAAACATTGCTGAAGAGCTAGTAAAACTCTTCAAGAAACAAATAGAACATGATAAG
AGAGAAATGATTTTTGAAGTTCTTGCTCCATTGGCAGAAAATGATGCTATTAAACTACAG
CTGGTTGAAGCAGGCCTAGTAGAGTGTCTACTAGAGATTGTTCAGCAAAAAGTGGATAGT
GACAAAGAAGATGATATTACTGAGCTCAAAACTGGTTCAGATCTCATGGTTTTATTACTT
CTTGGAGATGAATCCATGCAGAAGTTATTTGAAGGAGGAAAAGGTAGTGTATTTCAAAGG
GTACTCTCTTGGATCCCATCAAATAACCACCAGCTACAGCTTGCTGGAGCATTGGCAATT
GCAAATTTTGCCAGAAATGATGCAAATTGTATTCATATGGTAGACAATGGGATTGTAGAA
AAACTTATGGATTTACTGGACAGACATGTAGAAGATGGAAATGTAACAGTACAGCATGCA
GCACTAAGTGCCCTCAGAAACCTGGCCATTCCAGTTATAAATAAAGCAAAGATGTTATCA
GCTGGGGTCACAGAGGCAGTTTTGAAATTTCTTAAATCTGAAATGCCTCCTGTTCAGTTC
AAACTTCTGGGAACATTAAGAATGTTAATAGATGCACAAGCAGAAGCTGCTGAACAATTG
GGAAAGAATGTTAAGTTAGTGGAGCGTTTGGTGGAATGGTGTGAAGCCAAAGATCATGCT
GGTGTGATGGGGGAGTCAAACAGACTGCTGTCTGCCCTTATACGACACAGTAAATCAAAA
GATGTAATTAAAACCATTGTGCAGAGTGGTGGCATCAAGCATCTAGTTACCATGGCAACT
AGTGAACATGTAATAATGCAGAATGAAGCTCTTGTTGCTTTGGCATTAATAGCAGCTTTA
GAATTGGGCACTGCTGAGAAAGATCTAGAAAGTGCTAAACTTGTACAGATTTTACATAGA
CTGCTAGCAGATGAGAGAAGTGCTCCTGAAATCAAATATAATTCCATGGTCCTGATATGT
GCTCTTATGGGATCTGAATGTCTACACAAGGAAGTACAGGATTTGGCTTTTCTAGATGTC
GTATCCAAACTTCGCAGTCATGAGAACAAAAGTGTTGCCCAGCAGGCCTCTCTCACAGAG
CAGAGACTTACTGTGGAAAGCTGA
Protein Properties
Number of Residues 607
Molecular Weight 66316.2
Theoretical pI 4.97
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Rap1 GTPase-GDP dissociation stimulator 1
MDNLSDTLKKLKITAVDKTEDSLEGCLDCLLQALAQNNTETSEKIQASGILQLFASLLTP
QSSCKAKVANIIAEVAKNEFMRIPCVDAGLISPLVQLLNSKDQEVLLQTGRALGNICYDS
HEGRSAVDQAGGAQIVIDHLRSLCSITDPANEKLLTVFCGMLMNYSNENDSLQAQLINMG
VIPTLVKLLGIHCQNAALTEMCLVAFGNLAELESSKEQFASTNIAEELVKLFKKQIEHDK
REMIFEVLAPLAENDAIKLQLVEAGLVECLLEIVQQKVDSDKEDDITELKTGSDLMVLLL
LGDESMQKLFEGGKGSVFQRVLSWIPSNNHQLQLAGALAIANFARNDANCIHMVDNGIVE
KLMDLLDRHVEDGNVTVQHAALSALRNLAIPVINKAKMLSAGVTEAVLKFLKSEMPPVQF
KLLGTLRMLIDAQAEAAEQLGKNVKLVERLVEWCEAKDHAGVMGESNRLLSALIRHSKSK
DVIKTIVQSGGIKHLVTMATSEHVIMQNEALVALALIAALELGTAEKDLESAKLVQILHR
LLADERSAPEIKYNSMVLICALMGSECLHKEVQDLAFLDVVSKLRSHENKSVAQQASLTE
QRLTVES
GenBank ID Protein 155030196
UniProtKB/Swiss-Prot ID P52306
UniProtKB/Swiss-Prot Entry Name GDS1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001100427.1
GeneCard ID RAP1GDS1
GenAtlas ID RAP1GDS1
HGNC ID HGNC:9859
References
General References
  1. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  4. Kikuchi A, Kaibuchi K, Hori Y, Nonaka H, Sakoda T, Kawamura M, Mizuno T, Takai Y: Molecular cloning of the human cDNA for a stimulatory GDP/GTP exchange protein for c-Ki-ras p21 and smg p21. Oncogene. 1992 Feb;7(2):289-93. [PubMed:1549351 ]
  5. Vikis HG, Stewart S, Guan KL: SmgGDS displays differential binding and exchange activity towards different Ras isoforms. Oncogene. 2002 Apr 4;21(15):2425-32. [PubMed:11948427 ]