Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01802
Secondary Accession Numbers
  • 7160
Name Calbindin
Synonyms
  1. Calbindin D28
  2. D-28K
  3. Vitamin D-dependent calcium-binding protein, avian-type
Gene Name CALB1
Protein Type Unknown
Biological Properties
General Function Involved in calcium ion binding
Specific Function Buffers cytosolic calcium. May stimulate a membrane Ca(2+)-ATPase and a 3',5'-cyclic nucleotide phosphodiesterase
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
calcium ion binding
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:8
Locus 8q21.3-q22.1
SNPs CALB1
Gene Sequence
>786 bp
ATGGCAGAATCCCACCTGCAGTCATCCCTCATCACAGCCTCACAGTTTTTCGAGATCTGG
CTCCATTTCGACGCTGACGGAAGTGGTTACCTGGAAGGAAAGGAGCTGCAGAACTTGATC
CAGGAGCTCCAGCAGGCGCGAAAGAAGGCTGGATTGGAGTTATCACCTGAAATGAAAACT
TTTGTGGATCAGTATGGGCAAAGAGATGATGGAAAAATAGGAATTGTAGAGTTGGCTCAC
GTATTACCCACAGAAGAGAATTTCCTGCTGCTCTTCCGATGCCAGCAGCTGAAGTCCTGT
GAGGAATTCATGAAGACATGGAGAAAATATGATACTGACCACAGTGGCTTCATAGAAACT
GAGGAGCTTAAGAACTTTCTAAAGGACCTGCTAGAAAAAGCAAACAAGACTGTTGATGAC
ACAAAATTAGCCGAGTATACAGACCTAATGCTGAAACTATTTGATTCAAATAATGATGGG
AAGCTGGAATTAACTGAGATGGCCAGGTTACTACCAGTGCAGGAGAATTTTCTTCTTAAA
TTCCAGGGAATCAAAATGTGTGGGAAAGAGTTCAATAAGGCTTTTGAGCTGTATGATCAG
GACGGCAATGGATACATAGATGAAAATGAACTGGATGCTTTACTGAAGGATCTGTGCGAG
AAGAATAAACAGGATCTGGATATTAATAATATTACAACATACAAGAAGAACATAATGGCT
TTGTCGGATGGAGGGAAGCTGTACCGAACGGATCTTGCTCTTATTCTCTGTGCTGGGGAT
AACTAG
Protein Properties
Number of Residues 261
Molecular Weight 30024.8
Theoretical pI 4.44
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Calbindin
MAESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKT
FVDQYGQRDDGKIGIVELAHVLPTEENFLLLFRCQQLKSCEEFMKTWRKYDTDHSGFIET
EELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLK
FQGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIMA
LSDGGKLYRTDLALILCAGDN
GenBank ID Protein 4826655
UniProtKB/Swiss-Prot ID P05937
UniProtKB/Swiss-Prot Entry Name CALB1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_004929.2
GeneCard ID CALB1
GenAtlas ID CALB1
HGNC ID HGNC:1434
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Nusbaum C, Mikkelsen TS, Zody MC, Asakawa S, Taudien S, Garber M, Kodira CD, Schueler MG, Shimizu A, Whittaker CA, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Yang X, Allen NR, Anderson S, Asakawa T, Blechschmidt K, Bloom T, Borowsky ML, Butler J, Cook A, Corum B, DeArellano K, DeCaprio D, Dooley KT, Dorris L 3rd, Engels R, Glockner G, Hafez N, Hagopian DS, Hall JL, Ishikawa SK, Jaffe DB, Kamat A, Kudoh J, Lehmann R, Lokitsang T, Macdonald P, Major JE, Matthews CD, Mauceli E, Menzel U, Mihalev AH, Minoshima S, Murayama Y, Naylor JW, Nicol R, Nguyen C, O'Leary SB, O'Neill K, Parker SC, Polley A, Raymond CK, Reichwald K, Rodriguez J, Sasaki T, Schilhabel M, Siddiqui R, Smith CL, Sneddon TP, Talamas JA, Tenzin P, Topham K, Venkataraman V, Wen G, Yamazaki S, Young SK, Zeng Q, Zimmer AR, Rosenthal A, Birren BW, Platzer M, Shimizu N, Lander ES: DNA sequence and analysis of human chromosome 8. Nature. 2006 Jan 19;439(7074):331-5. [PubMed:16421571 ]
  3. Parmentier M, Lawson DE, Vassart G: Human 27-kDa calbindin complementary DNA sequence. Evolutionary and functional implications. Eur J Biochem. 1987 Dec 30;170(1-2):207-15. [PubMed:3691519 ]
  4. Parmentier M, De Vijlder JJ, Muir E, Szpirer C, Islam MQ, Geurts van Kessel A, Lawson DE, Vassart G: The human calbindin 27-kDa gene: structural organization of the 5' and 3' regions, chromosomal assignment, and restriction fragment length polymorphism. Genomics. 1989 Apr;4(3):309-19. [PubMed:2565876 ]
  5. Lutz W, Frank EM, Craig TA, Thompson R, Venters RA, Kojetin D, Cavanagh J, Kumar R: Calbindin D28K interacts with Ran-binding protein M: identification of interacting domains by NMR spectroscopy. Biochem Biophys Res Commun. 2003 Apr 18;303(4):1186-92. [PubMed:12684061 ]