You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01813
Secondary Accession Numbers
  • 7173
Name Glutamate receptor, ionotropic kainate 2
Synonyms
  1. EAA4
  2. Excitatory amino acid receptor 4
  3. GluR-6
  4. GluR6
  5. Glutamate receptor 6
Gene Name GRIK2
Protein Type Unknown
Biological Properties
General Function Involved in ionotropic glutamate receptor activity
Specific Function Ionotropic glutamate receptor. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. Binding of the excitatory neurotransmitter L- glutamate induces a conformation change, leading to the opening of the cation channel, and thereby converts the chemical signal to an electrical impulse. The receptor then desensitizes rapidly and enters a transient inactive state, characterized by the presence of bound agonist. May be involved in the transmission of light information from the retina to the hypothalamus. Modulates cell surface expression of NETO2
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
receptor activity
transmembrane receptor activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
molecular transducer activity
signal transducer activity
transporter activity
ion channel activity
ligand-gated ion channel activity
extracellular ligand-gated ion channel activity
excitatory extracellular ligand-gated ion channel activity
extracellular-glutamate-gated ion channel activity
glutamate receptor activity
ionotropic glutamate receptor activity
Process
establishment of localization
transport
ion transport
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
  3. Multi-pass membrane protein
  4. Cell junction
  5. synapse
  6. postsynaptic cell membrane
Gene Properties
Chromosome Location Chromosome:6
Locus 6q16.3-q21
SNPs GRIK2
Gene Sequence
>2727 bp
ATGAAGATTATTTTCCCGATTCTAAGTAATCCAGTCTTCAGGCGCACCGTTAAACTCCTG
CTCTGTTTACTGTGGATTGGATATTCTCAAGGAACCACACATGTATTAAGATTTGGTGGT
ATTTTTGAATATGTGGAATCTGGCCCAATGGGAGCTGAGGAACTTGCATTCAGATTTGCT
GTGAACACAATTAACAGAAACAGAACATTGCTACCCAATACTACCCTTACCTATGATACC
CAGAAGATAAACCTTTATGATAGTTTTGAAGCATCCAAGAAAGCCTGTGATCAGCTGTCT
CTTGGGGTGGCTGCCATCTTCGGGCCTTCACACAGCTCATCAGCAAACGCAGTGCAGTCC
ATCTGCAATGCTCTGGGAGTTCCCCACATACAGACCCGCTGGAAGCACCAGGTGTCAGAC
AACAAAGATTCCTTCTATGTCAGTCTCTACCCAGACTTCTCTTCACTCAGCCGTGCCATT
TTAGACCTGGTGCAGTTTTTCAAGTGGAAAACCGTCACGGTTGTGTATGATGACAGCACT
GGTCTCATTCGTTTGCAAGAGCTCATCAAAGCTCCATCAAGGTATAATCTTCGACTCAAA
ATTCGTCAGTTACCTGCTGATACAAAGGATGCAAAACCCTTACTAAAAGAAATGAAAAGA
GGCAAGGAGTTTCATGTAATCTTTGATTGTAGCCATGAAATGGCAGCAGGCATTTTAAAA
CAGGCATTAGCTATGGGAATGATGACAGAATACTATCATTATATCTTTACCACTCTGGAC
CTCTTTGCTCTTGATGTTGAGCCCTACCGATACAGTGGTGTTAACATGACAGGGTTCAGA
ATATTAAATACAGAAAATACCCAAGTCTCCTCCATCATTGAAAAGTGGTCGATGGAACGA
TTGCAGGCACCTCCGAAACCCGATTCAGGTTTGCTGGATGGATTTATGACGACTGATGCT
GCTCTAATGTATGATGCTGTGCATGTGGTGTCTGTGGCCGTTCAACAGTTTCCCCAGATG
ACAGTCAGTTCCTTGCAGTGTAATCGACATAAACCCTGGCGCTTCGGGACCCGCTTTATG
AGTCTAATTAAAGAGGCACATTGGGAAGGCCTCACAGGCAGAATAACTTTCAACAAAACC
AATGGCTTGAGAACAGATTTTGATTTGGATGTGATCAGTCTGAAGGAAGAAGGTCTAGAA
AAGATTGGAACGTGGGATCCAGCCAGTGGCCTGAATATGACAGAAAGTCAAAAGGGAAAG
CCAGCGAACATCACAGATTCCTTATCCAATCGTTCTTTGATTGTTACCACCATTTTGGAA
GAGCCTTATGTCCTTTTTAAGAAGTCTGACAAACCTCTCTATGGTAATGATCGATTTGAA
GGCTATTGCATTGATCTCCTCAGAGAGTTATCTACAATCCTTGGCTTTACATATGAAATT
AGACTTGTGGAAGATGGGAAATATGGAGCCCAGGATGATGCCAATGGACAATGGAATGGA
ATGGTTCGTGAACTAATTGATCATAAAGCTGACCTTGCAGTTGCTCCACTGGCTATTACC
TATGTTCGAGAGAAGGTCATCGACTTTTCCAAGCCCTTTATGACACTTGGAATAAGTATT
TTGTACCGCAAGCCCAATGGTACAAACCCAGGCGTCTTCTCCTTCCTGAATCCTCTCTCC
CCTGATATCTGGATGTATATTCTGCTGGCTTACTTGGGTGTCAGTTGTGTGCTCTTTGTC
ATAGCCAGGTTTAGTCCTTATGAGTGGTATAATCCACACCCTTGCAACCCTGACTCAGAC
GTGGTGGAAAACAATTTTACCTTGCTAAATAGTTTCTGGTTTGGAGTTGGAGCTCTCATG
CAGCAAGGTTCTGAGCTCATGCCCAAAGCACTGTCCACCAGGATAGTGGGAGGCATTTGG
TGGTTTTTCACACTTATCATCATTTCTTCGTATACTGCTAACTTAGCCGCCTTTCTGACA
GTGGAACGCATGGAATCCCCTATTGACTCTGCTGATGATTTAGCTAAACAAACCAAGATA
GAATATGGAGCAGTAGAGGATGGTGCAACCATGACTTTTTTCAAGAAATCAAAAATCTCC
ACGTATGACAAAATGTGGGCCTTTATGAGTAGCAGAAGGCAGTCAGTGCTGGTCAAAAGT
AATGAAGAAGGAATCCAGCGAGTCCTCACCTCTGATTATGCTTTCCTAATGGAGTCAACA
ACCATCGAGTTTGTTACCCAGCGGAACTGTAACCTGACACAGATTGGCGGCCTTATAGAC
TCTAAAGGTTATGGCGTTGGCACTCCCATGGGTTCTCCATATCGAGACAAAATTACCATA
GCAATTCTTCAGCTGCAAGAGGAAGGCAAACTGCATATGATGAAGGAGAAATGGTGGAGG
GGCAATGGTTGCCCAGAAGAGGAAAGCAAAGAGGCCAGTGCCCTGGGGGTTCAGAATATT
GGTGGCATCTTCATTGTTCTGGCAGCCGGCTTGGTGCTTTCAGTTTTTGTGGCAGTGGGA
GAATTTTTATACAAATCCAAAAAAAACGCTCAATTGGAAAAGAGGTCCTTCTGTAGTGCC
ATGGTAGAAGAATTGAGGATGTCCCTGAAGTGCCAGCGTCGGTTAAAACATAAGCCACAG
GCCCCAGTTATTGTGAAAACAGAAGAAGTTATCAACATGCACACATTTAACGACAGAAGG
TTGCCAGGTAAAGAAACCATGGCATAA
Protein Properties
Number of Residues 908
Molecular Weight 102582.5
Theoretical pI 8.01
Pfam Domain Function
Signals
  • 1-31
Transmembrane Regions
  • 562-582
  • 636-656
  • 820-840
Protein Sequence
>Glutamate receptor, ionotropic kainate 2
MKIIFPILSNPVFRRTVKLLLCLLWIGYSQGTTHVLRFGGIFEYVESGPMGAEELAFRFA
VNTINRNRTLLPNTTLTYDTQKINLYDSFEASKKACDQLSLGVAAIFGPSHSSSANAVQS
ICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSLSRAILDLVQFFKWKTVTVVYDDST
GLIRLQELIKAPSRYNLRLKIRQLPADTKDAKPLLKEMKRGKEFHVIFDCSHEMAAGILK
QALAMGMMTEYYHYIFTTLDLFALDVEPYRYSGVNMTGFRILNTENTQVSSIIEKWSMER
LQAPPKPDSGLLDGFMTTDAALMYDAVHVVSVAVQQFPQMTVSSLQCNRHKPWRFGTRFM
SLIKEAHWEGLTGRITFNKTNGLRTDFDLDVISLKEEGLEKIGTWDPASGLNMTESQKGK
PANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEI
RLVEDGKYGAQDDANGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISI
LYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSD
VVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLT
VERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKS
NEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITI
AILQLQEEGKLHMMKEKWWRGNGCPEEESKEASALGVQNIGGIFIVLAAGLVLSVFVAVG
EFLYKSKKNAQLEKRSFCSAMVEELRMSLKCQRRLKHKPQAPVIVKTEEVINMHTFNDRR
LPGKETMA
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q13002
UniProtKB/Swiss-Prot Entry Name GRIK2_HUMAN
PDB IDs
GenBank Gene ID U16126
GeneCard ID GRIK2
GenAtlas ID GRIK2
HGNC ID HGNC:4580
References
General References
  1. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404 ]
  2. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  3. Piserchio A, Pellegrini M, Mehta S, Blackman SM, Garcia EP, Marshall J, Mierke DF: The PDZ1 domain of SAP90. Characterization of structure and binding. J Biol Chem. 2002 Mar 1;277(9):6967-73. Epub 2001 Dec 14. [PubMed:11744724 ]
  4. Nutt SL, Kamboj RK: RNA editing of human kainate receptor subunits. Neuroreport. 1994 Dec 20;5(18):2625-9. [PubMed:7696618 ]
  5. Hoo KH, Nutt SL, Fletcher EJ, Elliott CE, Korczak B, Deverill RM, Rampersad V, Fantaske RP, Kamboj RK: Functional expression and pharmacological characterization of the human EAA4 (GluR6) glutamate receptor: a kainate selective channel subunit. Receptors Channels. 1994;2(4):327-37. [PubMed:7536611 ]
  6. Paschen W, Blackstone CD, Huganir RL, Ross CA: Human GluR6 kainate receptor (GRIK2): molecular cloning, expression, polymorphism, and chromosomal assignment. Genomics. 1994 Apr;20(3):435-40. [PubMed:8034316 ]
  7. Barbon A, Vallini I, Barlati S: Genomic organization of the human GRIK2 gene and evidence for multiple splicing variants. Gene. 2001 Aug 22;274(1-2):187-97. [PubMed:11675011 ]
  8. Paschen W, Hedreen JC, Ross CA: RNA editing of the glutamate receptor subunits GluR2 and GluR6 in human brain tissue. J Neurochem. 1994 Nov;63(5):1596-602. [PubMed:7523595 ]
  9. Motazacker MM, Rost BR, Hucho T, Garshasbi M, Kahrizi K, Ullmann R, Abedini SS, Nieh SE, Amini SH, Goswami C, Tzschach A, Jensen LR, Schmitz D, Ropers HH, Najmabadi H, Kuss AW: A defect in the ionotropic glutamate receptor 6 gene (GRIK2) is associated with autosomal recessive mental retardation. Am J Hum Genet. 2007 Oct;81(4):792-8. Epub 2007 Aug 31. [PubMed:17847003 ]