You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01839
Secondary Accession Numbers
  • 7207
Name Ig lambda chain V-II region MGC
Synonyms Not Available
Gene Name Not Available
Protein Type Enzyme
Biological Properties
General Function Involved in antigen binding
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs Not Available
Gene Sequence
>341 bp
CAGTCTGCCCTGACTCAGCCTCCCTCCGCGTCCGGGTCTCCTGGACAGTCAGTCACCATC
TCCTGCACTGGAACCAGCAGTGACGTTGGTGGTTATAACTATGTCTCCTGGTACCAACAG
CACCCAGGCAAAGCCCCCAAACTCATGATTTATGAGGTCAGTAAGCGGCCCTCAGGGGTC
CCTGATCGCTTCTCTGGCTCCAAGTCTGGCAACACGGCCTCCCTGACCGTCTCTGGGCTC
CAGGCTGAGGACGAGGCTGATTATTACTGCAGCTCATATGCAGGCAGCAACAATTTTGTG
TTCGGCAGTGGCACCAAGGTGACCGTCCTCGGTAAGTCTCC
Protein Properties
Number of Residues 111
Molecular Weight 11557.5
Theoretical pI 4.91
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Ig lambda chain V-II region MGC
QSALTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWYQQHAGKAPKVIIYEVNKRPSGV
PDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNFVFGTGTKVTVLG
GenBank ID Protein 86438996
UniProtKB/Swiss-Prot ID P01709
UniProtKB/Swiss-Prot Entry Name LV206_HUMAN
PDB IDs
GenBank Gene ID AM183998
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID Not Available
References
General References
  1. Fett JW, Deutsch HF: Primary structure of the Mcg lambda chain. Biochemistry. 1974 Sep 24;13(20):4102-14. [PubMed:4415202 ]
  2. Fett FW, Deutsch HF: A new lambda-chain gene. Immunochemistry. 1975 Aug;12(8):643-52. [PubMed:812801 ]
  3. Ely KR, Herron JN, Harker M, Edmundson AB: Three-dimensional structure of a light chain dimer crystallized in water. Conformational flexibility of a molecule in two crystal forms. J Mol Biol. 1989 Dec 5;210(3):601-15. [PubMed:2515285 ]