Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01844
Secondary Accession Numbers
  • 7215
Name Sodium/nucleoside cotransporter 1
Synonyms
  1. CNT 1
  2. Concentrative nucleoside transporter 1
  3. Na(+)/nucleoside cotransporter 1
  4. Sodium-coupled nucleoside transporter 1
  5. Solute carrier family 28 member 1
  6. hCNT1
Gene Name SLC28A1
Protein Type Unknown
Biological Properties
General Function Involved in nucleoside:sodium symporter activity
Specific Function Sodium-dependent and pyrimidine-selective. Exhibits the transport characteristics of the nucleoside transport system cit or N2 subtype (N2/cit) (selective for pyrimidine nucleosides and adenosine). It also transports the antiviral pyrimidine nucleoside analogs 3'-azido-3'-deoxythymidine (AZT) and 2',3'-dideoxycytidine (ddC). It may be involved in the intestinal absorption and renal handling of pyrimidine nucleoside analogs used to treat acquired immunodeficiency syndrome (AIDS). It has the following selective inhibition: adenosine, thymidine, cytidine, uridine >> guanosine, inosine.
Pathways
  • Capecitabine Action Pathway
  • Capecitabine Metabolism Pathway
  • Gemcitabine Action Pathway
  • Gemcitabine Metabolism Pathway
Reactions Not Available
GO Classification
Biological Process
nucleoside transport
pyrimidine-containing compound transmembrane transport
nucleobase-containing compound metabolic process
Cellular Component
apical plasma membrane
integral to plasma membrane
Component
membrane
cell part
Function
binding
nucleoside binding
transmembrane transporter activity
substrate-specific transmembrane transporter activity
nucleobase, nucleoside, nucleotide and nucleic acid transmembrane transporter activity
nucleoside transmembrane transporter activity
nucleoside:sodium symporter activity
transporter activity
Molecular Function
nucleoside binding
nucleoside transmembrane transporter activity
pyrimidine- and adenine-specific:sodium symporter activity
Process
establishment of localization
transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location 15
Locus 15q25.3
SNPs SLC28A1
Gene Sequence
>1950 bp
ATGGAGAACGACCCCTCGAGACGAAGAGAGTCCATCTCTCTCACACCTGTGGCCAAGGGT
CTGGAGAACATGGGGGCTGATTTCTTGGAAAGCCTGGAGGAAGGCCAGCTCCCTAGGAGT
GACTTGAGCCCCGCAGAGATCAGGAGCAGCTGGAGCGAGGCGGCGCCGAAGCCCTTCTCC
AGATGGAGGAACCTGCAGCCAGCCCTGAGAGCCAGAAGCTTCTGCAGGGAGCACATGCAG
CTGTTTCGATGGATCGGCACAGGCCTGCTCTGCACTGGGCTCTCTGCCTTCCTGCTGGTG
GCCTGCCTCCTGGATTTCCAGAGGGCCCTGGCTCTGTTTGTCCTCACCTGTGTGGTCCTC
ACCTTCCTGGGCCACCGCCTGCTGAAACGGCTTCTGGGGCCAAAGCTGAGGAGGTTTCTC
AAGCCTCAGGGCCATCCCCGCCTGCTGCTCTGGTTTAAGAGGGGTCTAGCTCTTGCTGCT
TTCCTGGGCCTGGTCCTGTGGCTGTCTCTGGACACCTCCCAGCGGCCTGAGCAACTGGTG
TCCTTCGCAGGAATCTGCGTGTTCGTCGCTCTCCTCTTTGCCTGCTCAAAGCATCATTGC
GCAGTGTCCTGGAGGGCCGTGTCTTGGGGACTTGGACTGCAGTTTGTACTTGGACTCCTC
GTCATCAGAACAGAACCAGGATTCATTGCGTTCGAGTGGCTGGGCGAGCAGATCCGGATC
TTCCTGAGCTACACGAAGGCTGGCTCCAGCTTCGTGTTTGGGGAGGCGCTGGTCAAGGAT
GTCTTTGCCTTTCAGGTTCTGCCCATCATTGTCTTTTTCAGCTGTGTCATATCCGTTCTC
TACCACGTGGGCCTCATGCAGTGGGTGATCCTGAAGATTGCCTGGCTGATGCAAGTCACC
ATGGGCACCACAGCCACTGAGACCCTGAGTGTGGCTGGAAACATCTTTGTGAGCCAGACC
GAGGCTCCATTACTGATCCGGCCCTACTTGGCAGACATGACACTCTCTGAAGTCCACGTT
GTCATGACCGGAGGTTACGCCACCATTGCTGGCAGCCTGCTGGGTGCCTACATCTCCTTT
GGGATCGATGCCACCTCGTTGATTGCAGCCTCTGTGATGGCTGCCCCTTGTGCCTTGGCC
CTCTCCAAGCTGGTCTACCCGGAGGTGGAGGAGTCCAAGTTTAGGAGGGAGGAAGGAGTG
AAACTGACCTATGGAGATGCTCAGAACCTCATAGAAGCAGCCAGCACTGGGGCCGCCATC
TCCGTGAAGGTGGTCGCCAACATCGCTGCCAACCTGATTGCGTTCCTGGCTGTGCTGGAC
TTTATCAATGCTGCCCTCTCCTGGCTGGGAGACATGGTGGACATCCAGGGGCTCAGCTTC
CAGCTCATCTGCTCCTACATCCTGCGGCCTGTAGCCTTCTTGATGGGTGTGGCGTGGGAG
GACTGCCCAGTGGTAGCTGAGCTGCTGGGGATCAAGCTGTTTCTGAACGAGTTTGTGGCC
TATCAAGACCTCTCCAAGTACAAGCAACGCCGCCTGGCAGGGGCCGAGGAGTGGGTCGGC
GACAGGAAGCAGTGGATCTCCGTCAGAGCTGAAGTCCTCACGACGTTTGCCCTCTGTGGA
TTTGCCAATTTCAGCTCCATTGGGATCATGCTGGGAGGCTTGACCTCCATGGTCCCCCAA
CGGAAGAGCGACTTCTCCCAGATAGTGCTCCGGGCGCTCTTCACGGGAGCCTGTGTGTCC
CTGGTGAACGCCTGTATGGCAGGGATCCTCTACATGCCCAGGGGGGCTGAAGTTGACTGC
ATGTCCCTCTTGAACACGACCCTCAGCAGCAGTAGCTTTGAGATTTACCAGTGCTGCCGT
GAGGCCTTCCAGAGCGTCAATCCAGAGTTCAGCCCAGAGGCCCTGGACAACTGCTGTCGG
TTTTACAACCACACGATCTGTGCACAGTGA
Protein Properties
Number of Residues 649
Molecular Weight 71583.18
Theoretical pI 7.596
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Sodium/nucleoside cotransporter 1
MENDPSRRRESISLTPVAKGLENMGADFLESLEEGQLPRSDLSPAEIRSSWSEAAPKPFS
RWRNLQPALRARSFCREHMQLFRWIGTGLLCTGLSAFLLVACLLDFQRALALFVLTCVVL
TFLGHRLLKRLLGPKLRRFLKPQGHPRLLLWFKRGLALAAFLGLVLWLSLDTSQRPEQLV
SFAGICVFVALLFACSKHHCAVSWRAVSWGLGLQFVLGLLVIRTEPGFIAFEWLGEQIRI
FLSYTKAGSSFVFGEALVKDVFAFQVLPIIVFFSCVISVLYHVGLMQWVILKIAWLMQVT
MGTTATETLSVAGNIFVSQTEAPLLIRPYLADMTLSEVHVVMTGGYATIAGSLLGAYISF
GIDATSLIAASVMAAPCALALSKLVYPEVEESKFRREEGVKLTYGDAQNLIEAASTGAAI
SVKVVANIAANLIAFLAVLDFINAALSWLGDMVDIQGLSFQLICSYILRPVAFLMGVAWE
DCPVVAELLGIKLFLNEFVAYQDLSKYKQRRLAGAEEWVGDRKQWISVRAEVLTTFALCG
FANFSSIGIMLGGLTSMVPQRKSDFSQIVLRALFTGACVSLVNACMAGILYMPRGAEVDC
MSLLNTTLSSSSFEIYQCCREAFQSVNPEFSPEALDNCCRFYNHTICAQ
GenBank ID Protein 42542381
UniProtKB/Swiss-Prot ID O00337
UniProtKB/Swiss-Prot Entry Name S28A1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_004213.3
GeneCard ID SLC28A1
GenAtlas ID SLC28A1
HGNC ID HGNC:11001
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Zody MC, Garber M, Sharpe T, Young SK, Rowen L, O'Neill K, Whittaker CA, Kamal M, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Kodira CD, Madan A, Qin S, Yang X, Abbasi N, Abouelleil A, Arachchi HM, Baradarani L, Birditt B, Bloom S, Bloom T, Borowsky ML, Burke J, Butler J, Cook A, DeArellano K, DeCaprio D, Dorris L 3rd, Dors M, Eichler EE, Engels R, Fahey J, Fleetwood P, Friedman C, Gearin G, Hall JL, Hensley G, Johnson E, Jones C, Kamat A, Kaur A, Locke DP, Madan A, Munson G, Jaffe DB, Lui A, Macdonald P, Mauceli E, Naylor JW, Nesbitt R, Nicol R, O'Leary SB, Ratcliffe A, Rounsley S, She X, Sneddon KM, Stewart S, Sougnez C, Stone SM, Topham K, Vincent D, Wang S, Zimmer AR, Birren BW, Hood L, Lander ES, Nusbaum C: Analysis of the DNA sequence and duplication history of human chromosome 15. Nature. 2006 Mar 30;440(7084):671-5. [PubMed:16572171 ]
  4. Ritzel MW, Yao SY, Huang MY, Elliott JF, Cass CE, Young JD: Molecular cloning and functional expression of cDNAs encoding a human Na+-nucleoside cotransporter (hCNT1). Am J Physiol. 1997 Feb;272(2 Pt 1):C707-14. [PubMed:9124315 ]
  5. Loewen SK, Ng AM, Yao SY, Cass CE, Baldwin SA, Young JD: Identification of amino acid residues responsible for the pyrimidine and purine nucleoside specificities of human concentrative Na(+) nucleoside cotransporters hCNT1 and hCNT2. J Biol Chem. 1999 Aug 27;274(35):24475-84. [PubMed:10455109 ]