Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01911
Secondary Accession Numbers
  • 7318
Name Cytochrome P450 26A1
Synonyms
  1. Cytochrome P450 retinoic acid-inactivating 1
  2. Cytochrome P450RAI
  3. Retinoic acid 4-hydroxylase
  4. Retinoic acid-metabolizing cytochrome
  5. hP450RAI
Gene Name CYP26A1
Protein Type Unknown
Biological Properties
General Function Involved in monooxygenase activity
Specific Function Plays a key role in retinoic acid metabolism. Acts on retinoids, including all-trans-retinoic acid (RA) and its stereoisomer 9-cis-RA. Capable of both 4-hydroxylation and 18- hydroxylation. Responsible for generation of several hydroxylated forms of RA, including 4-OH-RA, 4-oxo-RA and 18-OH-RA
Pathways
  • Retinol Metabolism
  • Vitamin A Deficiency
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
transition metal ion binding
electron carrier activity
iron ion binding
monooxygenase activity
heme binding
oxidoreductase activity
Cellular Location
  1. Peripheral membrane protein
  2. Peripheral membrane protein
  3. Endoplasmic reticulum membrane
  4. Microsome membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 10q23-q24
SNPs CYP26A1
Gene Sequence
>1494 bp
ATGGGGCTCCCGGCGCTGCTGGCCAGTGCGCTCTGCACCTTCGTGCTGCCGCTGCTGCTC
TTCCTGGCTGCGATCAAGCTCTGGGACCTGTACTGCGTGAGCGGCCGCGACCGCAGTTGT
GCCCTCCCATTGCCCCCCGGGACTATGGGCTTCCCCTTCTTTGGGGAAACCTTGCAGATG
GTACTGCAGCGGAGGAAGTTCCTGCAGATGAAGCGCAGGAAATACGGCTTCATCTACAAG
ACGCATCTGTTCGGGCGGCCCACCGTACGGGTGATGGGCGCGGACAATGTGCGGCGCATC
TTGCTCGGAGACGACCGGCTGGTGTCGGTCCACTGGCCAGCGTCGGTGCGCACCATTCTG
GGATCTGGCTGCCTCTCTAACCTGCACGACTCCTCGCACAAGCAGCGCAAGAAGGTGATT
ATGCGGGCCTTCAGCCGCGAGGCACTCGAATGCTACGTGCCGGTGATCACCGAGGAAGTG
GGCAGCAGCCTGGAGCAGTGGCTGAGCTGCGGCGAGCGCGGCCTCCTGGTCTACCCCGAG
GTGAAGCGCCTCATGTTCCGAATCGCCATGCGCATCCTACTGGGCTGCGAACCCCAACTG
GCGGGCGACGGGGACTCCGAGCAGCAGCTTGTGGAGGCCTTCGAGGAAATGACCCGCAAT
CTCTTCTCGCTGCCCATCGACGTGCCCTTCAGCGGGCTGTACCGGGGCATGAAGGCGCGG
AACCTCATTCACGCGCGCATCGAGCAGAACATTCGCGCCAAGATCTGCGGGCTGCGGGCA
TCCGAGGCGGGCCAGGGCTGCAAAGACGCGCTGCAGCTGTTGATCGAGCACTCGTGGGAG
AGGGGAGAGCGGCTGGACATGCAGGCACTAAAGCAATCTTCAACCGAACTCCTCTTTGGA
GGACACGAAACCACGGCCAGTGCAGCCACATCTCTGATCACTTACCTGGGGCTCTACCCA
CATGTTCTCCAGAAAGTGCGAGAAGAGCTGAAGAGTAAGGGTTTACTTTGCAAGAGCAAT
CAAGACAACAAGTTGGACATGGAAATTTTGGAACAACTTAAATACATCGGGTGTGTTATT
AAGGAGACCCTTCGACTGAATCCCCCAGTTCCAGGAGGGTTTCGGGTTGCTCTGAAGACT
TTTGAATTAAATGGATACCAGATTCCCAAGGGCTGGAATGTTATCTACAGTATCTGTGAT
ACTCATGATGTGGCAGAGATCTTCACCAACAAGGAAGAATTTAATCCTGACCGATTCATG
CTGCCTCACCCAGAGGATGCATCCAGGTTCAGCTTCATTCCATTTGGAGGAGGCCTTAGG
AGCTGTGTAGGCAAAGAATTTGCAAAAATTCTTCTCAAAATATTTACAGTGGAGCTGGCC
AGGCATTGTGACTGGCAGCTTCTAAATGGACCTCCTACAATGAAAACCAGTCCCACCGTG
TATCCTGTGGACAATCTCCCTGCAAGATTCACCCATTTCCATGGGGAAATCTGA
Protein Properties
Number of Residues 497
Molecular Weight 56198.1
Theoretical pI 8.83
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Cytochrome P450 26A1
MGLPALLASALCTFVLPLLLFLAAIKLWDLYCVSGRDRSCALPLPPGTMGFPFFGETLQM
VLQRRKFLQMKRRKYGFIYKTHLFGRPTVRVMGADNVRRILLGEHRLVSVHWPASVRTIL
GSGCLSNLHDSSHKQRKKVIMRAFSREALECYVPVITEEVGSSLEQWLSCGERGLLVYPE
VKRLMFRIAMRILLGCEPQLAGDGDSEQQLVEAFEEMTRNLFSLPIDVPFSGLYRGMKAR
NLIHARIEQNIRAKICGLRASEAGQGCKDALQLLIEHSWERGERLDMQALKQSSTELLFG
GHETTASAATSLITYLGLYPHVLQKVREELKSKGLLCKSNQDNKLDMEILEQLKYIGCVI
KETLRLNPPVPGGFRVALKTFELNGYQIPKGWNVIYSICDTHDVAEIFTNKEEFNPDRFM
LPHPEDASRFSFIPFGGGLRSCVGKEFAKILLKIFTVELARHCDWQLLNGPPTMKTSPTV
YPVDNLPARFTHFHGEI
GenBank ID Protein 2688846
UniProtKB/Swiss-Prot ID O43174
UniProtKB/Swiss-Prot Entry Name CP26A_HUMAN
PDB IDs Not Available
GenBank Gene ID AF005418
GeneCard ID CYP26A1
GenAtlas ID CYP26A1
HGNC ID HGNC:2603
References
General References
  1. Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR, Rogers J: The DNA sequence and comparative analysis of human chromosome 10. Nature. 2004 May 27;429(6990):375-81. [PubMed:15164054 ]
  2. White JA, Beckett-Jones B, Guo YD, Dilworth FJ, Bonasoro J, Jones G, Petkovich M: cDNA cloning of human retinoic acid-metabolizing enzyme (hP450RAI) identifies a novel family of cytochromes P450. J Biol Chem. 1997 Jul 25;272(30):18538-41. [PubMed:9228017 ]
  3. Sonneveld E, van den Brink CE, van der Leede BM, Schulkes RK, Petkovich M, van der Burg B, van der Saag PT: Human retinoic acid (RA) 4-hydroxylase (CYP26) is highly specific for all-trans-RA and can be induced through RA receptors in human breast and colon carcinoma cells. Cell Growth Differ. 1998 Aug;9(8):629-37. [PubMed:9716180 ]
  4. Trofimova-Griffin ME, Juchau MR: Expression of cytochrome P450RAI (CYP26) in human fetal hepatic and cephalic tissues. Biochem Biophys Res Commun. 1998 Nov 18;252(2):487-91. [PubMed:9826557 ]