Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01925
Secondary Accession Numbers
  • 7333
Name Class E basic helix-loop-helix protein 40
Synonyms
  1. Class B basic helix-loop-helix protein 2
  2. DEC1
  3. Differentially expressed in chondrocytes protein 1
  4. Enhancer-of-split and hairy-related protein 2
  5. SHARP-2
  6. Stimulated by retinoic acid gene 13 protein
  7. bHLHb2
  8. bHLHe40
Gene Name BHLHE40
Protein Type Unknown
Biological Properties
General Function Involved in transcription regulator activity
Specific Function May function as a transcriptional factor to modulate chondrogenesis in response to the cAMP pathway
Pathways Not Available
Reactions Not Available
GO Classification
Component
organelle
membrane-bounded organelle
intracellular membrane-bounded organelle
nucleus
Function
binding
transcription regulator activity
nucleic acid binding
dna binding
Process
biological regulation
regulation of biological process
regulation of metabolic process
regulation of macromolecule metabolic process
regulation of gene expression
regulation of transcription
regulation of transcription, dna-dependent
Cellular Location
  1. Nucleus
Gene Properties
Chromosome Location Chromosome:3
Locus 3p26
SNPs BHLHE40
Gene Sequence
>1239 bp
ATGGAGCGGATCCCCAGCGCGCAACCACCCCCCGCCTGCCTGCCCAAAGCACCGGGACTG
GAGCACGGAGACCTACCAGGGATGTACCCTGCCCACATGTACCAAGTGTACAAGTCAAGA
CGGGGAATAAAGCGGAGCGAGGACAGCAAGGAGACCTACAAATTGCCGCACCGGCTCATC
GAGAAAAAGAGACGTGACCGGATTAACGAGTGCATCGCCCAGCTGAAGGATCTCCTACCC
GAACATCTCAAACTTACAACTTTGGGTCACTTGGAAAAAGCAGTGGTTCTTGAACTTACC
TTGAAGCATGTGAAAGCACTAACAAACCTAATTGATCAGCAGCAGCAGAAAATCATTGCC
CTGCAGAGTGGTTTACAAGCTGGTGAGCTGTCAGGGAGAAATGTCGAAACAGGTCAAGAG
ATGTTCTGCTCAGGTTTCCAGACATGTGCCCGGGAGGTGCTTCAGTATCTGGCCAAGCAC
GAGAACACTCGGGACCTGAAGTCTTCGCAGCTTGTCACCCACCTCCACCGGGTGGTCTCG
GAGCTGCTGCAGGGTGGTACCTCCAGGAAGCCATCAGACCCAGCTCCCAAAGTGATGGAC
TTCAAGGAAAAACCCAGCTCTCCGGCCAAAGGTTCGGAAGGTCCTGGGAAAAACTGCGTG
CCAGTCATCCAGCGGACTTTCGCTCACTCGAGTGGGGAGCAGAGCGGCAGCGACACGGAC
ACAGACAGTGGCTATGGAGGAGAATCGGAGAAGGGCGACTTGCGCAGTGAGCAGCCGTGC
TTCAAAAGTGACCACGGACGCAGGTTCACGATGGGAGAAAGGATCGGCGCAATTAAGCAA
GAGTCCGAAGAACCCCCCACAAAAAAGAACCGGATGCAGCTTTCGGATGATGAAGGCCAT
TTCACTAGCAGTGACCTGATCAGCTCCCCGTTCCTGGGCCCACACCCACACCAGCCTCCT
TTCTGCCTGCCCTTCTACCTGATCCCACCTTCAGCGACTGCCTACCTGCCCATGCTGGAG
AAGTGCTGGTATCCCACCTCAGTGCCAGTGCTATACCCAGGCCTCAACGCCTCTGCCGCA
GCCCTCTCTAGCTTCATGAACCCAGACAAGATCTCGGCTCCCTTGCTCATGCCCCAGAGA
CTCCCTTCTCCCTTGCCAGCTCATCCGTCCGTCGACTCTTCTGTCTTGCTCCAAGCTCTG
AAGCCAATCCCCCCTTTAAACTTAGAAACCAAAGACTAA
Protein Properties
Number of Residues 412
Molecular Weight 45509.6
Theoretical pI 8.22
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Class E basic helix-loop-helix protein 40
MERIPSAQPPPACLPKAPGLEHGDLPGMYPAHMYQVYKSRRGIKRSEDSKETYKLPHRLI
EKKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHVKALTNLIDQQQQKIIA
LQSGLQAGELSGRNVETGQEMFCSGFQTCAREVLQYLAKHENTRDLKSSQLVTHLHRVVS
ELLQGGTSRKPSDPAPKVMDFKEKPSSPAKGSEGPGKNCVPVIQRTFAHSSGEQSGSDTD
TDSGYGGESEKGDLRSEQPCFKSDHGRRFTMGERIGAIKQESEEPPTKKNRMQLSDDEGH
FTSSDLISSPFLGPHPHQPPFCLPFYLIPPSATAYLPMLEKCWYPTSVPVLYPGLNASAA
ALSSFMNPDKISAPLLMPQRLPSPLPAHPSVDSSVLLQALKPIPPLNLETKD
GenBank ID Protein 2308997
UniProtKB/Swiss-Prot ID O14503
UniProtKB/Swiss-Prot Entry Name BHE40_HUMAN
PDB IDs Not Available
GenBank Gene ID AB004066
GeneCard ID BHLHE40
GenAtlas ID BHLHE40
HGNC ID HGNC:1046
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Shen M, Kawamoto T, Yan W, Nakamasu K, Tamagami M, Koyano Y, Noshiro M, Kato Y: Molecular characterization of the novel basic helix-loop-helix protein DEC1 expressed in differentiated human embryo chondrocytes. Biochem Biophys Res Commun. 1997 Jul 18;236(2):294-8. [PubMed:9240428 ]
  3. Teramoto M, Nakamasu K, Noshiro M, Matsuda Y, Gotoh O, Shen M, Tsutsumi S, Kawamoto T, Iwamoto Y, Kato Y: Gene structure and chromosomal location of a human bHLH transcriptional factor DEC1 x Stra13 x SHARP-2/BHLHB2. J Biochem. 2001 Mar;129(3):391-6. [PubMed:11226878 ]
  4. Ivanova AV, Ivanov SV, Danilkovitch-Miagkova A, Lerman MI: Regulation of STRA13 by the von Hippel-Lindau tumor suppressor protein, hypoxia, and the UBC9/ubiquitin proteasome degradation pathway. J Biol Chem. 2001 May 4;276(18):15306-15. Epub 2001 Feb 6. [PubMed:11278694 ]