Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01934
Secondary Accession Numbers
  • 7344
Name Pantetheinase
Synonyms
  1. Pantetheine hydrolase
  2. Tiff66
  3. Vanin-1
  4. Vascular non-inflammatory molecule 1
Gene Name VNN1
Protein Type Enzyme
Biological Properties
General Function Involved in hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides
Specific Function Amidohydrolase that hydrolyzes specifically one of the carboamide linkages in D-pantetheine thus recycling pantothenic acid (vitamin B5) and releasing cysteamine.
Pathways
  • Pantothenate and CoA biosynthesis
  • Pantothenate and CoA Biosynthesis
Reactions
Pantetheine + Water → Pantothenic acid + Cysteamine details
GO Classification
Biological Process
acute inflammatory response
negative regulation of apoptotic process
cellular component movement
response to oxidative stress
pantothenate metabolic process
innate immune response
cell-cell adhesion
chronic inflammatory response
positive regulation of T cell differentiation in thymus
Cellular Component
anchored to membrane
plasma membrane
integral to membrane
Function
catalytic activity
hydrolase activity
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides
Molecular Function
GPI anchor binding
pantetheine hydrolase activity
Process
metabolic process
nitrogen compound metabolic process
Cellular Location
  1. Cell membrane
  2. Lipid-anchor
  3. GPI-anchor (Potential)
Gene Properties
Chromosome Location 6
Locus 6q23-q24
SNPs VNN1
Gene Sequence
>1542 bp
ATGACTACTCAGTTGCCAGCTTACGTGGCAATTTTGCTTTTCTATGTCTCAAGAGCCAGC
TGCCAGGACACTTTCATTGCAGCTGTTTATGAGCATGCAGCGATATTGCCCAATGCCACC
CTAACACCAGTGTCTCGTGAGGAGGCTTTGGCATTAATGAATCGGAATCTGGACATTTTG
GAAGGAGCGATCACATCAGCAGCAGATCAGGGTGCGCATATTATTGTGACTCCAGAAGAT
GCTATTTATGGCTGGAACTTCAACAGGGACTCTCTCTACCCATATTTGGAGGACATCCCA
GACCCTGAAGTAAACTGGATCCCCTGTAATAATCGTAACAGATTTGGCCAGACCCCAGTA
CAAGAAAGACTCAGCTGCCTGGCCAAGAACAACTCTATCTATGTTGTGGCAAATATTGGG
GACAAGAAGCCATGCGATACCAGTGATCCTCAGTGTCCCCCTGATGGCCGTTACCAATAC
AACACTGATGTGGTATTTGATTCTCAAGGAAAACTGGTGGCACGCTACCATAAGCAAAAC
CTTTTCATGGGTGAAAATCAATTCAATGTACCCAAGGAGCCTGAGATTGTGACTTTCAAT
ACCACCTTTGGAAGTTTTGGCATTTTCACATGCTTTGATATACTCTTCCATGATCCTGCT
GTTACCTTGGTGAAAGATTTCCACGTGGACACCATAGTATTCCCAACAGCTTGGATGAAT
GTTTTGCCACATTTGTCAGCTGTTGAATTCCACTCAGCTTGGGCTATGGGCATGAGGGTC
AATTTCCTTGCATCCAACATACATTACCCCTCAAAGAAAATGACAGGAAGTGGCATCTAT
GCACCCAATTCTTCAAGAGCATTTCATTATGATATGAAGACAGAAGAGGGAAAACTCCTC
CTCTCGCAACTGGATTCCCACCCATCCCATTCTGCAGTGGTGAACTGGACTTCCTATGCC
AGCAGTATAGAAGCGCTCTCATCAGGAAACAAGGAATTTAAAGGCACTGTCTTTTTCGAT
GAATTCACTTTTGTGAAGCTCACAGGAGTTGCAGGAAATTATACAGTTTGTCAGAAAGAT
CTCTGCTGTCATTTAAGCTACAAAATGTCTGAGAACATACCAAATGAAGTGTACGCTCTA
GGGGCATTTGACGGACTGCACACTGTGGAAGGGCGCTATTATCTACAGATTTGTACCCTG
TTGAAATGTAAAACGACTAATTTAAACACTTGCGGTGACTCAGCTGAAACAGCTTCTACC
AGGTTTGAAATGTTCTCCCTCAGTGGCACTTTCGGAACCCAGTATGTCTTTCCTGAGGTG
TTGCTGAGTGAAAATCAGCTTGCACCTGGAGAATTTCAGGTGTCAACTGACGGACGCTTG
TTTAGTCTGAAGCCAACATCCGGACCTGTCTTAACAGTAACTCTGTTTGGGAGGTTGTAT
GAGAAGGACTGGGCATCAAATGCTTCATCAGGCCTCACAGCACAAGCAAGAATAATAATG
CTAATAGTTATAGCACCTATTGTATGCTCATTAAGTTGGTAG
Protein Properties
Number of Residues 513
Molecular Weight 57011.16
Theoretical pI 5.554
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Pantetheinase
MTTQLPAYVAILLFYVSRASCQDTFTAAVYEHAAILPNATLTPVSREEALALMNRNLDIL
EGAITSAADQGAHIIVTPEDAIYGWNFNRDSLYPYLEDIPDPEVNWIPCNNRNRFGQTPV
QERLSCLAKNNSIYVVANIGDKKPCDTSDPQCPPDGRYQYNTDVVFDSQGKLVARYHKQN
LFMGENQFNVPKEPEIVTFNTTFGSFGIFTCFDILFHDPAVTLVKDFHVDTIVFPTAWMN
VLPHLSAVEFHSAWAMGMRVNFLASNIHYPSKKMTGSGIYAPNSSRAFHYDMKTEEGKLL
LSQLDSHPSHSAVVNWTSYASSIEALSSGNKEFKGTVFFDEFTFVKLTGVAGNYTVCQKD
LCCHLSYKMSENIPNEVYALGAFDGLHTVEGRYYLQICTLLKCKTTNLNTCGDSAETAST
RFEMFSLSGTFGTQYVFPEVLLSENQLAPGEFQVSTDGRLFSLKPTSGPVLTVTLFGRLY
EKDWASNASSGLTAQARIIMLIVIAPIVCSLSW
GenBank ID Protein 4128047
UniProtKB/Swiss-Prot ID O95497
UniProtKB/Swiss-Prot Entry Name VNN1_HUMAN
PDB IDs Not Available
GenBank Gene ID AJ132099
GeneCard ID VNN1
GenAtlas ID VNN1
HGNC ID HGNC:12705
References
General References
  1. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404 ]
  2. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [PubMed:19159218 ]
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  5. Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80. [PubMed:16335952 ]
  6. Kristiansen TZ, Bunkenborg J, Gronborg M, Molina H, Thuluvath PJ, Argani P, Goggins MG, Maitra A, Pandey A: A proteomic analysis of human bile. Mol Cell Proteomics. 2004 Jul;3(7):715-28. Epub 2004 Apr 14. [PubMed:15084671 ]
  7. Galland F, Malergue F, Bazin H, Mattei MG, Aurrand-Lions M, Theillet C, Naquet P: Two human genes related to murine vanin-1 are located on the long arm of human chromosome 6. Genomics. 1998 Oct 15;53(2):203-13. [PubMed:9790769 ]
  8. Maras B, Barra D, Dupre S, Pitari G: Is pantetheinase the actual identity of mouse and human vanin-1 proteins? FEBS Lett. 1999 Nov 19;461(3):149-52. [PubMed:10567687 ]
  9. Martin F, Malergue F, Pitari G, Philippe JM, Philips S, Chabret C, Granjeaud S, Mattei MG, Mungall AJ, Naquet P, Galland F: Vanin genes are clustered (human 6q22-24 and mouse 10A2B1) and encode isoforms of pantetheinase ectoenzymes. Immunogenetics. 2001 May-Jun;53(4):296-306. [PubMed:11491533 ]
  10. Jansen PA, Kamsteeg M, Rodijk-Olthuis D, van Vlijmen-Willems IM, de Jongh GJ, Bergers M, Tjabringa GS, Zeeuwen PL, Schalkwijk J: Expression of the vanin gene family in normal and inflamed human skin: induction by proinflammatory cytokines. J Invest Dermatol. 2009 Sep;129(9):2167-74. doi: 10.1038/jid.2009.67. Epub 2009 Mar 26. [PubMed:19322213 ]